DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT2 and GstD8

Sequence 1:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_524916.1 Gene:GstD8 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster

Alignment Length:197 Identity:56/198 (28%)
Similarity:100/198 (51%) Gaps:21/198 (11%)


Human     3 LELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTES 67
            ::.:....|.|.|:|.:.||..|:.|.::.:.::.|:....||:::|....:|||.|..|.:.||
  Fly     1 MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWES 65

Human    68 SAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKV 132
            .||||||..||...|..||||.|.:|.|::.|.:....:..:|     |:.:.|         ::
  Fly    66 RAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSF-----VEAIYP---------QI 116

Human   133 ERNRTAMDQALQWLE------DKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLA 191
            ..|..|..:|:|.::      |.||.|:.::||..:|:||:..|..:.....:.:::.: .|.:|
  Fly   117 RNNHPADPEAMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQ-YPNVA 180

Human   192 AW 193
            .|
  Fly   181 RW 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 26/75 (35%)
GstA 14..210 CDD:223698 54/187 (29%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 1/1 (100%)
GST_C_Theta 91..216 CDD:198292 23/110 (21%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 56/198 (28%)
GST_N_Delta_Epsilon 1..74 CDD:239343 25/73 (34%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/111 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C95567022
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.