DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT2 and GstD3

Sequence 1:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_788656.1 Gene:GstD3 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster

Alignment Length:177 Identity:47/178 (26%)
Similarity:87/178 (49%) Gaps:9/178 (5%)


Human    22 KKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYP 86
            |..|:....:.::.:||:..:.:|::||....:|||.|..|.:.||.|||:||..||...|..||
  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYP 68

Human    87 SDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFL 151
            .|:|.:|.:::.|.:....:..|.....:........|.:...:||:       :...:| :.||
  Fly    69 KDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQ-------ETFDFL-NTFL 125

Human   152 GDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVE 198
            ..:.::||.|.|:||:..|..:.....:|:::.: .|.:|.|...|:
  Fly   126 EGQDYVAGDQYTVADIAILANVSNFDVVGFDISK-YPNVARWYDHVK 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 20/56 (36%)
GstA 14..210 CDD:223698 47/178 (26%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 1/1 (100%)
GST_C_Theta 91..216 CDD:198292 21/109 (19%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 19/54 (35%)
GstA 6..173 CDD:223698 46/176 (26%)
GST_C_Delta_Epsilon 72..188 CDD:198287 22/110 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C95567056
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D518126at33208
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.