DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT2 and GstD2

Sequence 1:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster

Alignment Length:170 Identity:49/171 (29%)
Similarity:82/171 (48%) Gaps:16/171 (9%)


Human     7 LDLVSQPS----RAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTES 67
            :|....|.    |.|.:.||..|:.|..:.::.::|:....||:::|....:|||.|..|.:.||
  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65

Human    68 SAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVP--KE 130
            .||.:||..||...|:..|:|.:.||.:::.|.:....:..:|     .:...||.....|  .|
  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESF-----AKYYYPLFRTGKPGSDE 125

Human   131 KVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMAL 170
            .::|..||..     ..|.||..:.::||.|:|:||:..|
  Fly   126 DLKRIETAFG-----FLDTFLEGQEYVAGDQLTVADIAIL 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 24/75 (32%)
GstA 14..210 CDD:223698 47/164 (29%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 1/1 (100%)
GST_C_Theta 91..216 CDD:198292 21/83 (25%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 23/73 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C95567092
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.