DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT2 and GstD11

Sequence 1:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_001138040.1 Gene:GstD11 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster

Alignment Length:188 Identity:59/189 (31%)
Similarity:91/189 (48%) Gaps:13/189 (7%)


Human    11 SQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLS 75
            |.|.|::.:.||...|..||:.|::::|:....:|:.:|....:||:.|...:|.||.|||.||.
  Fly    33 SPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAILSYLV 97

Human    76 CKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMD 140
            ..|...|..||:|::.||.|.:.|.:..    ||..:.| .....|.:.:..|.:  |..|..:.
  Fly    98 AAYGKSDQLYPTDIRVRALVDQRLQFDL----GTLYMRL-TDYYFPTMFIGAPLD--EGKRAKLA 155

Human   141 QALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRP--RLAAWRGR 196
            :|:.|| :..|..|.|.|....|:|||..|..:.|..|..:||   ||  .:..|..|
  Fly   156 EAVGWL-NTILEGRQFSAADHFTIADLTLLVTVSQLEAFEFEL---RPYKHIRQWLDR 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 23/67 (34%)
GstA 14..210 CDD:223698 57/186 (31%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 1/1 (100%)
GST_C_Theta 91..216 CDD:198292 31/109 (28%)
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 23/65 (35%)
GstA 27..221 CDD:223698 59/189 (31%)
GST_C_Delta_Epsilon 112..231 CDD:198287 31/110 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.