DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT2 and gfzf

Sequence 1:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_001014610.1 Gene:gfzf FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster

Alignment Length:178 Identity:49/179 (27%)
Similarity:83/179 (46%) Gaps:16/179 (9%)


Human    13 PSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCK 77
            ||.||.:..|...|..:|..||....:|:|:|:.::|...::|.|.|..|.|:||.||:.||..|
  Fly   822 PSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSESIAIMQYLCDK 886

Human    78 YQTPDHWYPSDLQARARVHEYLGWHADCIR-GTFGIPLWVQVLGPLI----GVQVPKEKVERNRT 137
            |......||.|:..||.:::.|     |.. |.:..|:....:.|:.    ...:..:||:....
  Fly   887 YAPDSTLYPQDVNVRAVINQRL-----CFNMGFYYAPISAHSMAPIFFDYKRTPMSLKKVQNALD 946

Human   138 AMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFE 185
            ..:..||.|..|      :.||:.:|:||...:...:...|:.::|.:
  Fly   947 VFETYLQRLGTK------YAAGENITIADFALISATICLEAINFDLHQ 988

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 25/65 (38%)
GstA 14..210 CDD:223698 48/178 (27%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 1/1 (100%)
GST_C_Theta 91..216 CDD:198292 20/101 (20%)
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 24/64 (38%)
GstA 812..1000 CDD:223698 49/179 (27%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 20/101 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.