DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT2 and Gdap1

Sequence 1:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_647945.1 Gene:Gdap1 FlyBaseID:FBgn0035587 Length:327 Species:Drosophila melanogaster

Alignment Length:227 Identity:46/228 (20%)
Similarity:87/228 (38%) Gaps:75/228 (33%)


Human    33 VDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSD--------- 88
            |||..|:..|..||.:|..|.:|.|:||..::..|:.|:.|:..|::......|:.         
  Fly    58 VDLCNGEQYSNWFLNLNPKGDVPVLQDGALVIPSSTHIINYVESKFRGDRSLKPAHNSKEFDQML 122

Human    89 --LQARAR-----------VHE---------YLG-WHADCIRGTFGIPLWVQVLGPL-------- 122
              .||.||           :|:         ::| ....|::..      .:||..|        
  Fly   123 IFEQAMARLPVGTLSLGSFIHDDLKLVPKAPFIGPVRQSCLKNN------EKVLDLLRHSVDEQA 181

Human   123 ---------IGVQVPKEKVERNRTAMDQALQ-------WLEDKFLGDRP---FLAGQQVTLADL- 167
                     :.:|:.:.::..:|....:.|.       ::|.:.....|   :|.|.::::||: 
  Fly   182 TKKAALQHKLDIQLRRHELASSREEFQKVLDAVRHFLLYVEQELTAQAPRVEWLTGDELSVADIS 246

Human   168 --MALEELMQPVALGYE----LFEGRPRLAAW 193
              :.|..|.|   ||:|    .|...|::.|:
  Fly   247 LGLLLHRLYQ---LGFENQFWTFGKLPQVEAY 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 17/45 (38%)
GstA 14..210 CDD:223698 46/228 (20%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 0/1 (0%)
GST_C_Theta 91..216 CDD:198292 27/159 (17%)
Gdap1NP_647945.1 GST_N_family 28..100 CDD:238319 16/42 (38%)
GstA 30..290 CDD:223698 46/228 (20%)
GST_C_family 178..285 CDD:295467 18/102 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.