DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT2 and GstE12

Sequence 1:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_001246500.1 Gene:GstE12 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster

Alignment Length:211 Identity:69/212 (33%)
Similarity:103/212 (49%) Gaps:31/212 (15%)


Human     5 LFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSA 69
            |:...:|.|||||.:.||..|:.||||.::|:||:|.:.|||::|....:|||.||:..:.:|.|
  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70

Human    70 ILIYLSCKY-QTPDHWYPSDLQARARVHEYLGWHADC----IRGTFGIPLWVQVLGPLIGVQVPK 129
            |..||..|| |.....||.:|..||.|...|  |.|.    .|..|   |:..:|      ....
  Fly    71 ICAYLVEKYGQKEQQLYPKELVQRANVDARL--HLDSGHLFARLRF---LYEPIL------YYGS 124

Human   130 EKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQ-----PVALGYELFEGRPR 189
            .....::.|..|....:.:.||.|:|:|.|..:|:||..|:..:..     |:    :.|: .|:
  Fly   125 TDCSIDKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPI----DEFK-FPK 184

Human   190 LAAWRGRVEAFLGAEL 205
            :.||..|:     |||
  Fly   185 MHAWLKRL-----AEL 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 33/73 (45%)
GstA 14..210 CDD:223698 66/203 (33%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 0/1 (0%)
GST_C_Theta 91..216 CDD:198292 31/125 (25%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 32/71 (45%)
GstA 6..201 CDD:223698 69/212 (33%)
GST_C_Delta_Epsilon 92..210 CDD:198287 31/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92108540
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.