DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT2 and GstE6

Sequence 1:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_611328.1 Gene:GstE6 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster

Alignment Length:193 Identity:59/194 (30%)
Similarity:92/194 (47%) Gaps:16/194 (8%)


Human    11 SQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLS 75
            |.|.|||.:......:..|...||:|.....|.|:|:.|....:|||:|....:.:|.||:.||.
  Fly    12 SPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLV 76

Human    76 CKYQTPDHWYPSDLQARARVHEYLGWHADCI--RGTFGIPLWVQVLGPLIGVQVPKEKVERNRTA 138
            .||...|..||.|...||.|.:.|.:.:..:  .|...|...|...|.   .:||||:.:    |
  Fly    77 SKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQ---TKVPKERYD----A 134

Human   139 MDQALQWLEDKFLGDRPFLAGQQVTLAD---LMALEELMQPVALGYELFEGRPRLAAWRGRVE 198
            :.:...::| .||..:.::||.|:|:||   :.::..|...|||....:   ||:.||..::|
  Fly   135 IIEIYDFVE-TFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKY---PRIGAWIKKLE 193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 23/67 (34%)
GstA 14..210 CDD:223698 57/191 (30%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 0/1 (0%)
GST_C_Theta 91..216 CDD:198292 31/114 (27%)
GstE6NP_611328.1 GstA 4..196 CDD:223698 59/194 (30%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/65 (34%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/115 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92108692
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127168
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.