DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT2 and GstE1

Sequence 1:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_611323.1 Gene:GstE1 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster

Alignment Length:201 Identity:66/202 (33%)
Similarity:101/202 (50%) Gaps:17/202 (8%)


Human     2 GLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTE 66
            |:.|:...:|...|.|.:..|...:..|.:.|:|..|:|.|:|:::.|....:|.|.|....:.:
  Fly     5 GIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWD 69

Human    67 SSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTF---GIPLWVQVLGPLIGV-QV 127
            |.||..||..||...|..||.||..||.|::.|.:.|..|..:.   ..|.|:.      || :|
  Fly    70 SHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWIN------GVTEV 128

Human   128 PKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQ-PVALGYELFEGRPRLA 191
            |:||::    |:.|.|:.|| .|||:.|:|||..:|||||.....:.. |.|:..:. ...|::.
  Fly   129 PQEKLD----AVHQGLKLLE-TFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDP-ATYPKVT 187

Human   192 AWRGRV 197
            ||..|:
  Fly   188 AWLDRL 193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 22/75 (29%)
GstA 14..210 CDD:223698 63/190 (33%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 0/1 (0%)
GST_C_Theta 91..216 CDD:198292 37/113 (33%)
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 21/73 (29%)
GstA 8..197 CDD:223698 65/199 (33%)
GST_C_Delta_Epsilon 94..210 CDD:198287 37/113 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92108869
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127168
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.