DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT2 and GstE14

Sequence 1:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_610855.1 Gene:GstE14 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster

Alignment Length:197 Identity:63/198 (32%)
Similarity:95/198 (48%) Gaps:24/198 (12%)


Human     5 LFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSA 69
            |:.|..|.|.|:..:..|...|.:|||.|:|.||:...|:||.:|....:|||..||.:||:|.|
  Fly     8 LYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHA 72

Human    70 ILIYLSCKYQTPDHWYPSDLQARARVHEYLGWH--------ADCIRGTFGIPLWVQVLGPLIGVQ 126
            |||:|:.|:......:|.:...|.:|...|.:.        :|.:..|        |......|.
  Fly    73 ILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSAT--------VRQGFANVD 129

Human   127 VPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLA 191
            |...  ||..|   :|...:| ::|.:..|:||.|:||||| ::...:..|.|.:.|.: .|||.
  Fly   130 VAHH--ERKLT---EAYIIME-RYLENSDFMAGPQLTLADL-SIVTTLSTVNLMFPLSQ-FPRLR 186

Human   192 AW 193
            .|
  Fly   187 RW 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 32/73 (44%)
GstA 14..210 CDD:223698 59/189 (31%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 0/1 (0%)
GST_C_Theta 91..216 CDD:198292 30/112 (27%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 63/198 (32%)
GST_N_Delta_Epsilon 6..79 CDD:239343 31/71 (44%)
GST_C_Delta_Epsilon 94..209 CDD:198287 30/112 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.