DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT2 and GstT1

Sequence 1:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_610509.2 Gene:GstT1 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster

Alignment Length:233 Identity:75/234 (32%)
Similarity:111/234 (47%) Gaps:25/234 (11%)


Human     3 LELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTES 67
            ::.:.|.:||||||::|..|....|.|...|.|.|.:..:.|:..||...|:|.:.||.|.|.||
  Fly     5 IKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGES 69

Human    68 SAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIR---GTFGIPLWVQVLGPLIGV-QVP 128
            .:|:.||:.|....:..||..|:.||||.|:|.|....:|   ..|...:|   |.|..|: ..|
  Fly    70 VSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVW---LLPAKGLAPAP 131

Human   129 K--------EKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFE 185
            |        :.||.|...:::.  |||      :.||.|.::|:||:....|:.|.....|.:.|
  Fly   132 KPESVKKLIKDVESNLGLLERL--WLE------KDFLVGDKLTVADIFGSSEINQMKLCQYNVNE 188

Human   186 GR-PRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAK 222
            .: |::|.|..||..... ....||||.:....:||.|
  Fly   189 KQFPKVAKWMERVRDATN-PYYDEAHSFVYKTSQQAVK 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 29/75 (39%)
GstA 14..210 CDD:223698 66/209 (32%)
Glutathione binding. {ECO:0000250} 53..54 1/1 (100%)
Glutathione binding. {ECO:0000250} 66..67 1/1 (100%)
GST_C_Theta 91..216 CDD:198292 40/138 (29%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 68/210 (32%)
GST_N_Theta 5..80 CDD:239348 29/75 (39%)
GST_C_Theta 93..218 CDD:198292 40/137 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C95553703
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 1 1.000 T130104
orthoMCL 1 0.900 OOG5_127168
Panther 1 1.100 O PTHR43917
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.