DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT2 and GstE13

Sequence 1:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_001188889.1 Gene:GstE13 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster

Alignment Length:245 Identity:67/246 (27%)
Similarity:103/246 (42%) Gaps:53/246 (22%)


Human     5 LFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGD-FILTESS 68
            |:..|.|.|:||..:.||..|:.|||:.||..|.:|.|:||:::|...::|...|.| .:..:|.
  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70

Human    69 AILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVE 133
            ||:.:|..||...|..||.||:.||.:...:.:....:                  .||.|:.|.
  Fly    71 AIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVL------------------FQVVKDIVA 117

Human   134 RN------------RTAMDQALQWLEDKFLGDRPFLAGQQVTLADL-----MALEELMQPVALGY 181
            ||            .|....|...|| .||....|:.|.::::||:     :...:|:.||..  
  Fly   118 RNIYGGEGEYNPRSLTLCHNAYSDLE-HFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVER-- 179

Human   182 ELFEGRPRLAAWRGRVEAFL---------GAELCQEAHSIILSILEQAAK 222
               |..|:...|..|::..|         ||...|.  .|:..:.|..||
  Fly   180 ---EKYPQTKQWMERMDKLLPDNEEINLKGARALQT--RILSCMAENKAK 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 28/74 (38%)
GstA 14..210 CDD:223698 59/223 (26%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 0/1 (0%)
GST_C_Theta 91..216 CDD:198292 30/151 (20%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 27/72 (38%)
GST_C_Delta_Epsilon 92..211 CDD:198287 28/143 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92108614
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.