DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT2 and GstT4

Sequence 1:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_572886.2 Gene:GstT4 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster

Alignment Length:209 Identity:67/210 (32%)
Similarity:105/210 (50%) Gaps:16/210 (8%)


Human     3 LELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFL-QINSLGKLPTLKDGDFILTE 66
            |:.:.|.::|.|||:||..:.:.||.|...:.::||:|.:.||. .:|...|||.:.|..:.|:|
  Fly     5 LKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSE 69

Human    67 SSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPL-------WVQVLGPLIG 124
            :.||..:|:.:...|:||||.....|:|:.|||.|.    :...|:..       |   |.|.:.
  Fly    70 NVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQ----QTNMGVATTEYFQQKW---LVPYLQ 127

Human   125 VQVPKEK-VERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRP 188
            ...|.:. |......::..|...|..||..|.|:.|..::.|||.|:.|:.||.::||..|:.|.
  Fly   128 KTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRN 192

Human   189 RLAAWRGRVEAFLG 202
            :||.|...|...||
  Fly   193 KLARWYETVREELG 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 26/76 (34%)
GstA 14..210 CDD:223698 64/199 (32%)
Glutathione binding. {ECO:0000250} 53..54 1/1 (100%)
Glutathione binding. {ECO:0000250} 66..67 1/1 (100%)
GST_C_Theta 91..216 CDD:198292 36/121 (30%)
GstT4NP_572886.2 GstA 5..203 CDD:223698 65/205 (32%)
GST_N_Theta 5..80 CDD:239348 26/75 (35%)
GST_C_Theta 95..220 CDD:198292 36/120 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4428
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 1 1.000 T130104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43917
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.