DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT2 and GstT2

Sequence 1:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_724816.3 Gene:GstT2 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster

Alignment Length:238 Identity:70/239 (29%)
Similarity:116/239 (49%) Gaps:35/239 (15%)


Human     3 LELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTES 67
            :..:.||:|..:|.::|..|.:..|:|...:.|.|.:..:.|:.:||...|:|.:..|||.|:|:
  Fly     5 IRFYYDLLSPIARGLWIGLKFSNSPVEYCPIALRKFEQLTDEYKKINRFQKVPAIVGGDFHLSET 69

Human    68 SAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIR---GTFGIPLWVQVLGPLIGVQVPK 129
            .||:.||:.|.|..:..||..|:.||||.|:|.|....||   ..:....|   |.|:.|: .||
  Fly    70 IAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAW---LFPMNGI-APK 130

Human   130 EK----------VERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELF 184
            .|          ||.|...:::.  |||:      .||.|:.:|:||::...|:.|.....|.:.
  Fly   131 PKPEQIQALIEGVENNLGLLERL--WLEN------DFLVGKNLTMADILGSSEINQLRLCQYRVD 187

Human   185 EGR-PRLAAW--RGRVEAFLGAELCQEAHSIILSILEQAAKKT 224
            |.: |::..|  |.||.|       ...|...|:.:::.:|::
  Fly   188 EKKFPKVVKWLERVRVSA-------NPYHDEGLTFIDRKSKQS 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 25/75 (33%)
GstA 14..210 CDD:223698 64/212 (30%)
Glutathione binding. {ECO:0000250} 53..54 1/1 (100%)
Glutathione binding. {ECO:0000250} 66..67 1/1 (100%)
GST_C_Theta 91..216 CDD:198292 40/141 (28%)
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 25/75 (33%)
GstA 7..202 CDD:223698 64/207 (31%)
GST_C_family 93..218 CDD:295467 40/144 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C95553778
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127168
Panther 1 1.100 O PTHR43917
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.