DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ptgs2 and cd

Sequence 1:NP_058928.3 Gene:Ptgs2 RGDID:620349 Length:604 Species:Rattus norvegicus
Sequence 2:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster

Alignment Length:573 Identity:120/574 (21%)
Similarity:199/574 (35%) Gaps:157/574 (27%)


  Rat   102 VLTSRSHLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEK 166
            |..::.|    |.||..          |.:.|.....|..||....|. |..:..||.:::|..|
  Fly   224 VCNNKQH----PRTYGA----------SMVPYRRMVSPDYADGIAAPR-VSHHGRLPPARQVSLK 273

  Rat   167 VLLRREFIPDPQGTNMMFAFFAQHFTHQFFKTD-------------------------------- 199
            : .|..:..|...| :|.|.|.|...|....|.                                
  Fly   274 I-HRSSYETDSNFT-VMLAVFGQFMDHDITATSLTTSQEGESIDCCVAATREQHPECYPVDILPD 336

  Rat   200 --------------QKRGPGFTRGLGHGVDLNH---------VYGETLDRQHKLRLFQDGKLKYQ 241
                          .:..|..|...|..:.||.         |||....||::||.|.:|.|:..
  Fly   337 DPYYKQYNISCMNFVRSAPAPTGRFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGSLRMF 401

  Rat   242 VI--GGEVYP----PTVKDTQVDMIYPPHVPEHLRFAVGQEVF---------GLVPGLMMYATIW 291
            |.  |.::.|    |.....:|.|.           .:|:..|         .|:  |.....:|
  Fly   402 VTDDGRQLLPISSNPADGCNRVQMT-----------RLGKYCFESGDDRANENLL--LTSMHLLW 453

  Rat   292 LREHNRVCDILKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKL----------- 345
            .|.||.:...|::::|.|:||||:|.:|.||..:...|...:::..|.|.:...           
  Fly   454 ARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNL 518

  Rat   346 ----KFDPELLFNQQFQYQNRIASEF--NTLYHWHPLLPDTFNIEDQEYT-----FKQFLYNN-S 398
                .:|||:        ...||:.|  ......|.|||..|||.....|     ..:.|:|. |
  Fly   519 NAPDTYDPEV--------DPSIANCFAAAAFRFAHTLLPGLFNISRDNSTPEAIELHKMLFNPFS 575

  Rat   399 ILLEHGLAHFVES------------FTRQIAGRVAGGR---NVPIAVQAVAKASIDQSREMKYQS 448
            :..|||:.|.:.:            |:.::..::..|.   .||:....:...:|.:.|:....|
  Fly   576 LWAEHGIDHALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPS 640

  Rat   449 LNEYRKRFSLKPYTSFEELTGEKEMAA--ELKALYHDIDAMELYPALLVEKPRPDAIFGETMVEL 511
            ...:|:...|....::||::...:.|.  .::.:|.....:::|...|.|.|...||||..:..:
  Fly   641 YPVFRRHCRLPTVDTWEEMSQAIDNATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCM 705

  Rat   512 GAPFSLKGLMGNPICSPQYWKPSTFGGE----VGFRIINTASIQSLICNNVKG 560
            .:...|:..:|:     .:|.....|.:    .....|...|:.::||.|..|
  Fly   706 VSDQFLRLKLGD-----SHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDG 753

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ptgs2NP_058928.3 EGF 21..53 CDD:278437
prostaglandin_endoperoxide_synthase 75..562 CDD:188648 120/574 (21%)
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 120/574 (21%)
peroxinectin_like 364..750 CDD:188655 90/412 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.