DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT1 and GstE12

Sequence 1:NP_000844.2 Gene:GSTT1 HGNCID:4641 Length:240 Species:Homo sapiens
Sequence 2:NP_001246500.1 Gene:GstE12 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster

Alignment Length:229 Identity:72/230 (31%)
Similarity:111/230 (48%) Gaps:33/230 (14%)


Human     5 LYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVA 69
            ||...||.|.|||.:.||...:..|||.::|:||:||:..|.::||...:|.|.||:.|:.:|.|
  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70

Human    70 ILLYLTRKY-KVPDYWYPQDLQARARVDE--YLAWQHTTLRRSCLRALWHKVMFPVFLGEPV--- 128
            |..||..|| :.....||::|..||.||.  :|...|...|   ||          ||.||:   
  Fly    71 ICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFAR---LR----------FLYEPILYY 122

Human   129 -SPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGR-PKL 191
             |.......:|.:....::||. ||:::.:|.|..:::||..|:..:. .|.....:.|.: ||:
  Fly   123 GSTDCSIDKIAYIQKCWEILEG-FLKDQPYLCGSDLTIADFCAVATVT-SVNDTAPIDEFKFPKM 185

Human   192 ATWRQRVEAAVGEDLFQEAH-------EVILKAK 218
            ..|.:|:...   ..:||.:       :.|.|||
  Fly   186 HAWLKRLAEL---PYYQEVNGDGADELKSIFKAK 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 32/73 (44%)
Glutathione binding. {ECO:0000305|PubMed:16298388} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000305|PubMed:16298388} 66..67 0/1 (0%)
GST_C_Theta 91..216 CDD:198292 33/139 (24%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 31/71 (44%)
GstA 6..201 CDD:223698 68/213 (32%)
GST_C_Delta_Epsilon 92..210 CDD:198287 32/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.