DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gstt2 and GstD2

Sequence 1:NP_036928.1 Gene:Gstt2 RGDID:69362 Length:244 Species:Rattus norvegicus
Sequence 2:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster

Alignment Length:174 Identity:47/175 (27%)
Similarity:79/175 (45%) Gaps:24/175 (14%)


  Rat     7 LDLLSQPS----RAVYIFAKKNGIPFQLRTVDLLKGQHLSEQFSQVNCLKKVPVLKDGSFVLTES 67
            :|....|.    |.|.:.||..|:....:.::.::|:.|..:|.::|....:|.|.|..|.:.||
  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65

  Rat    68 TAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQVPEEKV 132
            .||.:||..||...|:..|.|.:.||.:::.|.:....:..:|     .|...||.....|....
  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESF-----AKYYYPLFRTGKPGSDE 125

  Rat   133 ERNRNSMVLALQRLE------DKFLRDRAFIAGQQVTLADLMSL 170
            :         |:|:|      |.||..:.::||.|:|:||:..|
  Fly   126 D---------LKRIETAFGFLDTFLEGQEYVAGDQLTVADIAIL 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gstt2NP_036928.1 GstA 3..210 CDD:223698 47/175 (27%)
GST_N_Theta 3..78 CDD:239348 22/75 (29%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 1/1 (100%)
GST_C_Theta 91..216 CDD:198292 21/87 (24%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 21/73 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C95567502
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.