DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prdx2 and Jafrac2

Sequence 1:NP_058865.1 Gene:Prdx2 RGDID:3838 Length:198 Species:Rattus norvegicus
Sequence 2:NP_001261350.1 Gene:Jafrac2 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster

Alignment Length:193 Identity:134/194 (69%)
Similarity:156/194 (80%) Gaps:0/194 (0%)


  Rat     6 AHIGKPAPDFTGTAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGC 70
            |.|.||||.|.|||||:....::.||.|.||||||.|||||||||||||||||||...:|:|:..
  Fly    50 AVISKPAPQFEGTAVVNKEIVKLSLSQYLGKYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKT 114

  Rat    71 EVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAK 135
            ||:||||||.|||||||||||||||||.:.||||:|:|..:|::|||.....|.|.|||||||..
  Fly   115 EVIGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQT 179

  Rat   136 GVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN 198
            |||||||:|||||||||||.:||||||||||.|||||||||:||:|||.||.::..:||:|:|
  Fly   180 GVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIVPNPEEKTKYFAKNN 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prdx2NP_058865.1 PTZ00253 1..195 CDD:140280 132/189 (70%)
PRX_Typ2cys 8..179 CDD:239313 123/171 (72%)
Jafrac2NP_001261350.1 AhpC 51..241 CDD:223527 132/190 (69%)
PRX_Typ2cys 52..223 CDD:239313 123/171 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1326484at2759
OrthoFinder 1 1.000 FOG0000331
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126593
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.