DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp2c7 and Cyp303a1

DIOPT Version :9

Sequence 1:NP_058854.1 Gene:Cyp2c7 / 29298 RGDID:620379 Length:490 Species:Rattus norvegicus
Sequence 2:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster


Alignment Length:518 Identity:134/518 - (25%)
Similarity:241/518 - (46%) Gaps:56/518 - (10%)


- Green bases have known domain annotations that are detailed below.


  Rat     6 FLVLTLSSLILLSLWRQSSRR-RKLPPGPTPLPIIGNFLQID---------VKNISQSLTKFSKT 60
            :.|:.:....||::.....|: ::.||||...||:|:.||:.         .|.|.....::...
  Fly     3 YTVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNP 67

  Rat    61 YGPVFTLYLGSQPTVILHGYEAIKEALIDNGEKFSGR--GSYPMNENVTKGFGIVFSNGNRWKEM 123
            || .:.|.:|....||.:..:||.|.:  ..|...||  |.:..........|::.::|..|.|.
  Fly    68 YG-FYGLKIGKDKVVIAYTNDAISEMM--TNEDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQ 129

  Rat   124 RRFTIMNFRNLGIGKRNIEDRVQEEAQCLVEELR----KTKGSPCDPSL-------ILNCAPCNV 177
            |||.:.:.:|.|..:..:.|.|..||.||:::|:    |:.|......:       :||...|  
  Fly   130 RRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWC-- 192

  Rat   178 ICSITFQNHFDYKDKEMLTFMEKVNENLKIMSSPWMQVCNSFPSLIDYFP---------GTHHKI 233
               :.....::....|:...:|...|..|.:        :...:|..:||         ..::..
  Fly   193 ---MLSGRRYEPGSPEITQLLETFFELFKNI--------DMVGALFSHFPLLRFIAPNFSGYNGF 246

  Rat   234 AKNINYMKSYLLKKIEEHQESL-DVTNPRDFVDYYLIKQKQANNIEQSEYSHENLTCSIMDLIGA 297
            .::...:.:::.|:||.|:.:. :...|||.:|.||..|.:.|: |:..:|.::|....:|:..|
  Fly   247 VESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGND-EKGMFSDQSLLAICLDMFLA 310

  Rat   298 GTETMSTTLRYALLLLMKYPHVTAKVQEEIDRVIGRHRSP-CMQDRKHMPYTDAMIHEVQRFINF 361
            |:||.:.:|.:..:.|:..|.:..:..:||..|:|..|.| ..:||..:||.:|:..|..|....
  Fly   311 GSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFML 375

  Rat   362 VPTNLPHAVTCDIKFRNYLIPKGTKVLTSLTSVLHDSKEFPNPEMFDPGHFLDENGNFKKSDYFL 426
            ....:||...||.:...|.|||.|.|:.....:|.:..:||:||.|:|..:|.: |:.|..:.|.
  Fly   376 HTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLKLPEAFN 439

  Rat   427 PFSAGKRACVGEGLARMQLFLFLTTILQNFNLKSLVHPKDI-DTMPVLNGFASLPPTYQLCFI 488
            ||..|:..|:|:.|.|..||:|.||:||||.:.::  |..: :.:|:....|::.| |.:..:
  Fly   440 PFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAI--PGQVPEEVPLEGATAAVKP-YDIMLV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp2c7NP_058854.1 p450 30..487 CDD:278495 130/490 (27%)
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 126/471 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.