DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp2c7 and Cyp303a1

Sequence 1:XP_008757831.1 Gene:Cyp2c7 RGDID:620379 Length:513 Species:Rattus norvegicus
Sequence 2:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster

Alignment Length:517 Identity:133/518 (26%)
Similarity:236/518 (46%) Gaps:54/518 (10%)


  Rat    29 FLVLTLSSLILLSLWRQSSRR-RKLPPGPTPLPIIGNFLQID---------VKNISQSLTKFSKT 83
            :.|:.:....||::.....|: ::.||||...||:|:.||:.         .|.|.....::...
  Fly     3 YTVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNP 67

  Rat    84 YGPVFTLYLGSQPTVILHGYEAIKEALIDNGEKFSGR--GSYPMIENVTKGFGIVFSNGNRWKEM 146
            || .:.|.:|....||.:..:||.|.:  ..|...||  |.:..:.......|::.::|..|.|.
  Fly    68 YG-FYGLKIGKDKVVIAYTNDAISEMM--TNEDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQ 129

  Rat   147 RRFTIMTFRNLGIGKRNIEDRVQEEAQCLVEELR----KTKGSPCDPSL-------ILNCAPCNV 200
            |||.:...:|.|..:..:.|.|..||.||:::|:    |:.|......:       :||...|  
  Fly   130 RRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWC-- 192

  Rat   201 ICSITFQNHFDYKDKEMLTFMEKVNENLKIMSSPWMQVCNSFPSLIDYFP---------GTHHKI 256
               :.....::....|:...:|...|..|.:        :...:|..:||         ..::..
  Fly   193 ---MLSGRRYEPGSPEITQLLETFFELFKNI--------DMVGALFSHFPLLRFIAPNFSGYNGF 246

  Rat   257 AKNINYMKSYLLKKIEEHQESL-DVTNPRDFVDYYLIKQKQANNIEQSEYSHENLTCSIMDLIGA 320
            .::...:.:::.|:||.|:.:. :...|||.:|.||..|.:.|: |:..:|.::|....:|:..|
  Fly   247 VESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGND-EKGMFSDQSLLAICLDMFLA 310

  Rat   321 GTETMSTTLRYALLLLMKYPHVTAKVQEEIDRVIGRHRSP-CMQDRKHMPYTDAMIHEVQRFINF 384
            |:||.:.:|.:..:.|:..|.:..:..:||..|:|..|.| ..:||..:||.:|:..|..|....
  Fly   311 GSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFML 375

  Rat   385 VPTNLPHAVTCDIKFRNYLIPKGTKVLTSLTSVLHDSKEFPNPEMFDPGHFLDENGNFKKSDYFL 449
            ....:||...||.:...|.|||.|.|:.....:|.:..:||:||.|:|..:|.: |:.|..:.|.
  Fly   376 HTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLKLPEAFN 439

  Rat   450 PFSAGKRACVGEGLARMQLFLFLTTILQNFNLKSLVQPKDIDTRPVLNGFASLPPTYQLCFI 511
            ||..|:..|:|:.|.|..||:|.||:||||.:.::  |..:.....|.|..:....|.:..:
  Fly   440 PFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAI--PGQVPEEVPLEGATAAVKPYDIMLV 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp2c7XP_008757831.1 p450 53..510 CDD:278495 129/490 (26%)
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 126/472 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111195226
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.