DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Csrp1 and Mlp84B

Sequence 1:NP_058844.1 Gene:Csrp1 RGDID:62053 Length:193 Species:Rattus norvegicus
Sequence 2:NP_001303418.1 Gene:Mlp84B FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster

Alignment Length:182 Identity:95/183 (52%)
Similarity:118/183 (64%) Gaps:2/183 (1%)


  Rat     9 KCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGY 73
            ||..|.|:||.|||....|..|||:||.|.:|.|:||||....|..|:|||:|:|:|:||||||:
  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKGYGF 75

  Rat    74 GQGAGTLSMDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKS 138
            |.||||||||.|.....::.:.|..|..........|:...| |.||||...|||||:::..|:|
  Fly    76 GTGAGTLSMDNGSQFLRENGDVPSVRNGARLEPRAIARAPEG-EGCPRCGGYVYAAEQMLARGRS 139

  Rat   139 WHKSCFRCAKCGKGLESTTLAD-KDGEIYCKGCYAKNFGPKGFGFGQGAGAL 189
            |||.||:|..|.|||:|....: .|..|||||||||.|||||:|:|||.|||
  Fly   140 WHKECFKCGTCKKGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYGQGGGAL 191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Csrp1NP_058844.1 LIM1_CRP1 8..63 CDD:188863 28/54 (52%)
Nuclear localization signal. {ECO:0000255} 64..69 3/5 (60%)
LIM2_CRP 119..172 CDD:188787 30/54 (56%)
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 28/53 (53%)
LIM_CRP_like 120..173 CDD:188712 29/53 (55%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1214165at2759
OrthoFinder 1 1.000 FOG0000884
OrthoInspector 1 1.000 T618019
orthoMCL 1 0.900 OOG5_128738
Panther 1 1.100 O PTHR24215
Phylome 1 0.910 0.857 Consistency score
TreeFam 1 0.960
87.780

Return to query results.
Submit another query.