DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atp8b1 and CG33298

Sequence 1:NP_001099610.1 Gene:Atp8b1 RGDID:1308488 Length:1259 Species:Rattus norvegicus
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1356 Identity:419/1357 (31%)
Similarity:648/1357 (48%) Gaps:317/1357 (23%)


  Rat    91 KYASNAIKTYKYNALTFLPMNLFEQFKRAANFYFLILLILQAIPQISTLAWYTTLVPLLLVLGIT 155
            ::..|.|:|.||..|:|:|.||.|||.|.||.||:.:::|..:|:||.......::|:|.|||:|
  Fly   249 QFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVT 313

  Rat   156 AIKDLVDDVARHKMDKEINNRTCEVIKDG---RFKIIKWKDIQVGDVIRLKKNDFIPADILLLSS 217
            |:|||.:|..|...||.|||.||.|. ||   |:|.:||::::|||::.|..|:.:|||||||.:
  Fly   314 AVKDLFEDRRRRASDKRINNTTCRVY-DGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRT 377

  Rat   218 SEPNSLCYVETAELDGETNLKFKMALEITDQYLQIEDNL--ATFDGFIECEEPNNRLDKFTGTLF 280
            |:|..:||::|.:||||||||.:   |:...:.:::...  :.|...:|.:.|..:|.:|.|.|.
  Fly   378 SDPQGVCYIDTCDLDGETNLKRR---EVVRGFEEMQSIFVPSKFVSRVEADAPTTKLYRFHGALI 439

  Rat   281 W-RNQSFPLDADKILLRGCVIRNTDVCHGLVIFAGADTKIMKNSGKTRFKRTKIDYLMNY-MVYT 343
            . ..:..|:..:.:|||...::|||...|:|::||.:||.|.|:...|:||::::..||. :::.
  Fly   440 HPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWC 504

  Rat   344 IIIVLILVSAGLAIGHAYWEAQIGNYSWYLYDGENATPSYRGFLNFWGYIIVLNTMVPISLYVSV 408
            :||:|||...| |||...|.:...::..........|.:......||.||::|..|:|:||||::
  Fly   505 VIILLILCVVG-AIGCRMWLSSFTHFPVPYLPPNKLTANMESMWIFWTYIVILQVMIPLSLYVTI 568

  Rat   409 EVIRLGQSHFINWDLQMYYAEKDTPAKSRTTTLNEQLGQIHYIFSDKTGTLTQNIMTFKKCCING 473
            |:.::.|...|:.::.::.||.:...:.|...:.|:||||.:||:|||||||:|.|.|::|.:||
  Fly   569 ELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNG 633

  Rat   474 TIYGDHRDASQHSHSKIELVDFSW----------NEFADGKLAFYDH--YLIEQIQSGKEPEVRQ 526
            :.|       .|..|::|.: :|.          |:..:..:|....  ||....|     .:::
  Fly   634 SDY-------NHPPSELEKI-YSKPGAPAPPLIPNDNLNSDMAQLTQGTYLTPHAQ-----RIQE 685

  Rat   527 FFFLLSICHTVMV---------------------------------------------------- 539
            |..:|:||:||:|                                                    
  Fly   686 FLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIING 750

  Rat   540 ------------DR--------------------------------------------------- 541
                        ||                                                   
  Fly   751 PTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSP 815

  Rat   542 ------------------------------------------------------IDGQINYQAAS 552
                                                                  .||:..|:|.|
  Fly   816 PMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAES 880

  Rat   553 PDEGALVNAARNFGFAFLARTQNTITVS--ELGTERTYSVLAILDFNSDRKRMSIIVRTPEGS-- 613
            |||.||||||.::....|.|:.|.|.||  ..|..|.|.:|.:|.|:|.||.|||:|| ..||  
  Fly   881 PDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMSIVVR-QIGSQE 944

  Rat   614 IRLYCKGADTVIYERL----HRMNP---MKQETQDALDIFASETLRTLCLCYKEIEEKEFAEWNK 671
            |.||.||||:.|...|    |. :|   ::::||..||.:|.|.||.|.:..:.:...::.:|..
  Fly   945 IVLYTKGADSSIMPVLVPCSHN-SPEGILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWA 1008

  Rat   672 KFMAASVASSNRDEALDKVYEEIERDLILLGATAIEDKLQDGVPETISKLAKADIKIWVLTGDKK 736
            :.....::..||:..|...:.::|.:|.|||||.|||:|||||||||:.|..|.|.:|||||||.
  Fly  1009 RHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKP 1073

  Rat   737 ETAENIGFACELLTEDTTI----CYGED-----INSLLHTRMENQRNRG----GVSAKFAPPAYE 788
            |||.||.::.:|.|:...:    ....|     ||..| |.|||.:...    |.|.:       
  Fly  1074 ETAINIAYSAKLFTQQMELIRLTARSRDAAETAINFYL-TDMENDKTTSTLGYGQSLR------- 1130

  Rat   789 PFFPPGENRALIITGSWLNEILLEKKTKRSKILKLKFPRTEEERRMRSQSRRRLEEKKEQRQKNF 853
                 .:.|||::.|..|..||..|.       ||..|                          |
  Fly  1131 -----KKQRALVVDGKTLTFILDPKS-------KLILP--------------------------F 1157

  Rat   854 VDLACECSAVICCRVTPKQKAMVVDLVKRYKKAITLAIGDGANDVNMIKTAHIGVGISGQEGMQA 918
            :.|:..|::|:|||.||.|||.:|.:||......|||||||||||:||:.|.:||||||||||||
  Fly  1158 LRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQA 1222

  Rat   919 VMSSDYSFAQFRYLQRLLLVHGRWSYIRMCKFLRYFFYKNFAFTLVHFWYSFFNGYSAQTAYEDW 983
            ||::|::..:||||:||||.||.|.|.|:.:.:.||||||.||..:.|||..:.|:|.|...:..
  Fly  1223 VMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQM 1287

  Rat   984 FITLYNVLYSSLPVLLMGLLDQDVSDKLSLRFPGLYVVGQRDLLFNYKKFFVSLLHGVLTSMVLF 1048
            ::.|||::::|||.|.:|:.|:.|::.|.|:.|.||..|:..:.:....|::.||..:..|:|:|
  Fly  1288 YLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIF 1352

  Rat  1049 FIPFGAYLQTVGQDGEAPSDYQSFAVTMASALVITVNFQIGLDTSYWTFVNAFSIFGSIALY--F 1111
            |:...||       .|:......|..|:.::.:........::...||.::..||..|:..:  |
  Fly  1353 FVALCAY-------AESDVGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLF 1410

  Rat  1112 GIMFD---FHSAGIHVLFPSAFQFTGWCFSDSESTASNALRQPYIWLTIILTVAVCLLPVVAIRF 1173
            .|::|   .:..|:.    |::.....||:.:..           ||.|:|:..|.:||.:.:..
  Fly  1411 AIVYDSVCMNCFGVR----SSYWVIFVCFASAVH-----------WLVIMLSTVVAVLPRLLLTT 1460

  Rat  1174 LSMTIWPSESDKI--QKHRKRLKAEE---QWKRRQSVFRRGASS--RRSAYAFSHQ 1222
            :.:::.|.:|.|:  |..|:|.:.|.   .|.|..|     |||  |.:.|...:|
  Fly  1461 VRISLCPDDSTKVILQSKRERSRGEALLVTWSRSTS-----ASSIYRITDYGSKNQ 1511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atp8b1NP_001099610.1 PhoLip_ATPase_N 86..142 CDD:292826 22/51 (43%)
ATPase-Plipid 92..1187 CDD:273734 406/1314 (31%)
E1-E2_ATPase 171..>234 CDD:278548 33/66 (50%)
Cation_ATPase 534..628 CDD:289987 50/267 (19%)
HAD_like <875..919 CDD:304363 29/44 (66%)
PhoLip_ATPase_C 919..1181 CDD:292829 78/267 (29%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 22/50 (44%)
ATPase-Plipid 250..1473 CDD:273734 406/1311 (31%)
E1-E2_ATPase 302..>394 CDD:278548 46/93 (49%)
Cation_ATPase <880..965 CDD:289987 41/86 (48%)
HAD_like <1177..1240 CDD:304363 40/63 (63%)
PhoLip_ATPase_C 1223..1468 CDD:292829 78/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.