DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dhrs7c and CG31937

Sequence 1:NP_001258527.1 Gene:Dhrs7c RGDID:1306989 Length:311 Species:Rattus norvegicus
Sequence 2:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster

Alignment Length:227 Identity:57/228 (25%)
Similarity:111/228 (49%) Gaps:11/228 (5%)


  Rat     6 VLMLPLLLLGVSGLLFIYQEAS-RLWSK-------SAVQNKVVVITDALSGLGKECARVFNAGGA 62
            :|:|.:|...|..||:|..:.: .||.|       |:::.:||.||.|.||:|:..|......|.
  Fly     7 LLLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGV 71

  Rat    63 RLVLCGKNWEGLESLYAALTSVADPSKTFTPKLVL-LDLSDISCVEDVAKEVLDCYGCVDILINN 126
            :|||..:..|.||.:.....:.|.........||: :|:.|:...:.....||:.:..:|:|:||
  Fly    72 KLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNN 136

  Rat   127 ASVKVKGPAHKISLELDKKIMDANYFGPITFTKVLLPNMISRR--TGQIVLVNNIQAKFGIPFRT 189
            |....:....::.:|:|:::.:.:.|..:..:::::...:.:.  .|.|...::|.....:||..
  Fly   137 AGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSP 201

  Rat   190 AYAASKHAVMGFFDCLRAEVEEYDVVVSTVSP 221
            .|.|:|||:..:...|:.|:.:.||.:....|
  Fly   202 TYCAAKHALNAYLLSLKVEMRKLDVSLFAPGP 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dhrs7cNP_001258527.1 11beta-HSD1_like_SDR_c 35..296 CDD:187593 46/191 (24%)
PRK06181 37..293 CDD:235726 46/189 (24%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 46/191 (24%)
adh_short 47..245 CDD:278532 46/188 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D429842at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.