DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhrs7b and CG31937

DIOPT Version :9

Sequence 1:NP_001008507.1 Gene:Dhrs7b / 287380 RGDID:1311243 Length:325 Species:Rattus norvegicus
Sequence 2:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster


Alignment Length:286 Identity:89/286 - (31%)
Similarity:146/286 - (51%) Gaps:13/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Rat    46 SKAYLRNAVVVVTGATSGLGKECARVFHAAGAKVVLCGRNVKALEEFTRELADSSSSQGQTHQPC 110
            |.:.:|..||.:|||:||:|:..|......|.|:||..|.::.||:...|...::.....|....
  Fly    40 SLSSMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVL 104

  Rat   111 VVTFDLADPGAIAPAAAEILQCFGYVDILINNAGISYRGAISDTIVDVDRKVMEINYFGPVALTK 175
            |:..|:.|..........:|..|..:|:|:||||.|.|.:.::..::|||::.|::.|..|.|::
  Fly   105 VIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSR 169

  Rat   176 ALLPSMVERK--RGHIVAISSIQGKISIPFRSAYAASKHATQAFFDCLRAEMKDSDIEVTVISPG 238
            .::...||:.  ||||.|.|||.|...:||...|.|:|||..|:...|:.||:  .::|::.:||
  Fly   170 LVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMR--KLDVSLFAPG 232

  Rat   239 YIHTNLSVNAVTADGSRYGALDKNTA-QGRSAVEVAQDIFDAVGKKKKDVLLTDFLPT--MAVYI 300
            .|.|:....|.|  ||:.|.:..:|| |.|...:...|:|......|.|:......|.  :|...
  Fly   233 PIATDFLQEAFT--GSQGGKVGLSTANQKRMTAQRCGDLFAVALANKMDLTWCGLFPVNLLAYCA 295

  Rat   301 R--TLAPRLFFRIMASRA-RKERKSK 323
            |  ||: ::..::|..:. .|.|:.|
  Fly   296 RNPTLS-KILAQLMTEKTLNKIREGK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dhrs7bNP_001008507.1 11beta-HSD1_like_SDR_c 50..311 CDD:187593 84/267 (31%)
PRK06181 52..321 CDD:235726 85/276 (31%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 80/252 (32%)
adh_short 47..245 CDD:278532 67/201 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D429842at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.