DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATP11C and CG33298

Sequence 1:XP_016884928.1 Gene:ATP11C HGNCID:13554 Length:1152 Species:Homo sapiens
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1325 Identity:390/1326 (29%)
Similarity:602/1326 (45%) Gaps:300/1326 (23%)


Human    23 RTVFVGNH---PVSETEAYIAQRFCDNRIVSSKYTLWNFLPKNLFEQFRRIANFYFLIIFLVQ-V 83
            ||| |.||   |.:....:...:|..|:|.::||||.:|:||||.|||.|:||.||:.|.|:. |
  Fly   228 RTV-VPNHTVPPKTPKRDHPNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWV 291

Human    84 TVDTPTSPVTSGLPLFFVITVTAIKQGYEDCLRHRADNEVNKST--VYIIENAKRVRKESEKIKV 146
            ...:......:.:|:.||:.|||:|..:||..|..:|..:|.:|  ||..|..:..:.:.::::|
  Fly   292 PEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRV 356

Human   147 GDVVEVQADETFPCDLILLSSCTTDGTCYVTTASLDGESNCKTHYAVRDTIALCTAESIDTLRAA 211
            ||:|.:..:||.|.|::||.:....|.||:.|..||||:|.|....||....:.:........:.
  Fly   357 GDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVVRGFEEMQSIFVPSKFVSR 421

Human   212 IECEQPQPDLYKKMNQISLVHYQPRINHCGPRFVGRINIYSNSLEAVARSLGPENLLLKGATLKN 276
            :|.:.|...||:...  :|:|      ..|.|.                .:..|.|||:.:.|||
  Fly   422 VEADAPTTKLYRFHG--ALIH------PTGERV----------------PISTECLLLRESRLKN 462

Human   277 TEKIYGVAVYTGMETKMALNYQGKSQKRSAVEKSINAFLIVYLFILLTKAAVCTTLKYVWQST-- 339
            |:.|.|:.||.|.|||..||..|...|||.||:.:|..:|..:.|||....|......:|.|:  
  Fly   463 TDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWLSSFT 527

Human   340 ----PYNDEPWYNQKTQKERETLKVLKMFTDFLSFMVLFNFIIPVSMYVTVEMQKFLGSFFISWD 400
                ||...    .|.....|::.:      |.:::|:...:||:|:|||:|:.|.|..|.|..:
  Fly   528 HFPVPYLPP----NKLTANMESMWI------FWTYIVILQVMIPLSLYVTIELCKILQVFHIHNN 582

Human   401 KDFYDEEINEGALVNTSDLNEELGQVDYVFTDKTGTLTENSMEFIECCIDGHKYKGVTQEVDGLS 465
            .|.:|.|.|:.......::.|||||:.::|||||||||||.|.|..|.::|..|.....|::.:.
  Fly   583 VDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPSELEKIY 647

Human   466 QTDGT----LTYFDKVDKNREEL---------------FLRALCLCHTV---------------- 495
            ...|.    |...|.::.:..:|               ||..|.:|:||                
  Fly   648 SKPGAPAPPLIPNDNLNSDMAQLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGI 712

Human   496 -EIK---------------------------TNDAVDGAT-----------------ESAELT-- 513
             |::                           |...::|.|                 ||..:|  
  Fly   713 IEVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPS 777

Human   514 ----------------------------------------------------------------- 513
                                                                             
  Fly   778 PPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITS 842

Human   514 ---------------------------------YISSSPDEIALVKGAKRYGFTFLGNRNGYMRV 545
                                             |.:.||||:|||..|..|....|.      |.
  Fly   843 IATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLN------RS 901

Human   546 ENQ-------RKEIEEYELLHTLNFDAVRRRMSVIVKTQEG--DILLFCKGADSAVFPRVQ--NH 599
            .||       .....|||:|..|.||:.|:.||::|: |.|  :|:|:.|||||::.|.:.  :|
  Fly   902 PNQILVSMPMAGATREYEILKVLPFDSSRKCMSIVVR-QIGSQEIVLYTKGADSSIMPVLVPCSH 965

Human   600 EI------ELTKVHVERNAMDGYRTLCVAFKEIAPDDYERINRQLIEAKMALQDREEKMEKVFDD 658
            ..      |.|:..::|.|.:|.|.|.:|.:.:...||.....:..|.:|:|::||.::...|..
  Fly   966 NSPEGILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAK 1030

Human   659 IETNMNLIGATAVEDKLQDQAAETIEALHAAGLKVWVLTGDKMETAKSTCYACRLFQTNTELLEL 723
            :|:|:.|:|||.:||:|||...|||.:|.:||:.||||||||.|||.:..|:.:||....||:.|
  Fly  1031 LESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRL 1095

Human   724 TTKTIEESERKEDRLHELLIEYRKKLLHEFPKSTRSFKKAWTEHQEYGLIIDGSTLSLILNSSQD 788
            |.       |..|.....:..|...:.::...||..:.::..:.|. .|::||.||:.||:... 
  Fly  1096 TA-------RSRDAAETAINFYLTDMENDKTTSTLGYGQSLRKKQR-ALVVDGKTLTFILDPKS- 1151

Human   789 SSSNNYKSI--FLQICMKCTAVLCCRMAPLQKAQIVRMVK---NLKGSPITLSIGDGANDVSMIL 848
                  |.|  ||::..:|.:|||||..|||||.:|::||   ||:    ||:|||||||||||.
  Fly  1152 ------KLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLR----TLAIGDGANDVSMIQ 1206

Human   849 ESHVGIGIKGKEGRQAARNSDYSVPKFKHLKKLLLAHGHLYYVRIAHLVQYFFYKNLCFILPQFL 913
            .:.||:||.|:||.||...:|:::|:|::|::||||||:..|.|::.::.||||||..|:...|.
  Fly  1207 MADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFW 1271

Human   914 YQFFCGFSQQPLYDAAYLTMYNICFTSLPILAYSLLEQHINIDTLTSDPRLYMKISGNAMLQLGP 978
            ||.:||||.|.:.|..||.:||:.|||||.||..:.::.:..|.|..:|.||.  :|...:...|
  Fly  1272 YQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYK--NGRLGVAYRP 1334

Human   979 FLYWTFL--AAFEGTVFFFGTYFLFQTASLEENGKVYGNWTFGTIVFTVLVFTVTLKLALDTRFW 1041
            ..:|..|  |.::..|.||.....:..:.:       |.|.|||.:....:|...:..|::.|.|
  Fly  1335 HDFWLILLDALYQSLVIFFVALCAYAESDV-------GIWEFGTTITASCLFANLVHCAIEIRSW 1392

Human  1042 TWINHFVIWGSLAFYVFFSFFWGGIIWPFLKQQRMYFVFAQMLSSVSTWLAIILLIFISLFPEIL 1106
            |.::...|..||..:..|:..:..:.......:..|:|.....:|...||.|:|...:::.|.:|
  Fly  1393 TVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLL 1457

Human  1107 L--------------IVLKNVRRRS 1117
            |              ::|::.|.||
  Fly  1458 LTTVRISLCPDDSTKVILQSKRERS 1482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP11CXP_016884928.1 None
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 23/50 (46%)
ATPase-Plipid 250..1473 CDD:273734 379/1292 (29%)
E1-E2_ATPase 302..>394 CDD:278548 33/92 (36%)
Cation_ATPase <880..965 CDD:289987 34/92 (37%)
HAD_like <1177..1240 CDD:304363 34/67 (51%)
PhoLip_ATPase_C 1223..1468 CDD:292829 76/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.