DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCDC66 and CG13251

Sequence 1:NP_001340076.1 Gene:CCDC66 HGNCID:27709 Length:954 Species:Homo sapiens
Sequence 2:NP_649246.1 Gene:CG13251 FlyBaseID:FBgn0037014 Length:1088 Species:Drosophila melanogaster

Alignment Length:642 Identity:131/643 (20%)
Similarity:234/643 (36%) Gaps:194/643 (30%)


Human   423 HIAKPIKDVVMANSKKTNFLRSMTALLDPAQIEERDRRRQKQLEHQKAITAQVEEKRRKKQLEEE 487
            |..|..:|.|.:....:.:||...|.||...:.||..:|:|..|:..||..|:.|:...::.|.|
  Fly   445 HDLKDSEDDVQSMQSSSTYLRGQNAPLDAHTLAERMDKRRKAAEYHNAIKKQLHERELIRKWEHE 509

Human   488 QRKKEEQEEELRLAQEREEMQKQYEEDILKQKQKEEIMTLKTNELFQTMQRAQELAQRLKQEQR- 551
            :.::|||.||.|:.::::..|::.|.:....:::||....|...:...:|:|:..|:..:|::| 
  Fly   510 RHRQEEQIEEERIRRQKQLEQERLEFERRTLQEREEAQQKKQQVMLDAIQKAEVAAKMERQKRRM 574

Human   552 IRELAQKGHDT----SRLIKNLGGDFSLPVDTIQMEYNASNISNSRHDSDEISGKMN-TYMNSTT 611
            :|:.::...:|    |.||:         |.:::.|          .|::|.||.:. ......|
  Fly   575 VRQPSKVSQETEEDESELIR---------VQSVEEE----------EDAEEKSGAVEPPSQEEET 620

Human   612 SKKDTG----VQTDDLNIGIFTNAESHCGSLMERDITN-CSSPEISAELIGQFSTKKNKQELTQD 671
            |....|    :..:.:.||...|        :.|.||. ...|        :.|.|::.:|.||.
  Fly   621 SNTPRGAPPVMSEEKVLIGTPIN--------LRRTITKPIKQP--------RDSRKEDPKEPTQT 669

Human   672 KGASL----EKENNRCNDQ----------------CNQFTRIEKQTKHMKKYPKRPDWNINKPPK 716
            |..:.    :|||.....|                .|....::..|..|:.       .:.|||:
  Fly   670 KVQTTFLGEDKENVALLMQPATLIPLPVTSDIFGLQNAIGNLQIATYFMQP-------PMQKPPE 727

Human   717 RYIPASEKYPK-----------------QLQKQREEKKVRR------------------------ 740
              .|.|  |.|                 |.:|:.:.....|                        
  Fly   728 --TPGS--YSKATMTHRTDTSIYTEDGYQAEKEEDPLTTARSGRTDLVTASGCFSPDSLEVDVAP 788

Human   741 ----QMELLHLVEKNNPGHL-----SQNRG-ISPEIFHSSHQETESKLRWHLVKKEEEPLN---- 791
                :.:.|.|:....|..|     |.:|| .:.|:.|.:..||:::|          |||    
  Fly   789 VLIAETDKLALIPLKTPLQLGISNSSDDRGEHNHEVGHQADVETQTEL----------PLNCDLC 843

Human   792 -IHS------FSKERSPSSPVPVVKNRTQQTQNTLHLPLKNSSYERENLISGSNQTELSSGI--- 846
             .|.      ..:|.|.::.....|::||        |.|.|:.|:::..:.:..|..::..   
  Fly   844 LFHDNFYKVLLKREVSTTTTTQTSKSQTQ--------PAKESTAEKDHETTTTTTTTTTTTFKAK 900

Human   847 SESSHFIPYVRTN-----EIYYLDPDAPLSGPSTQDPQYQNSQDCGQKRQLFDSDCVRDPLLNPN 906
            |:.......::.|     :...:| |.|..|.:....||..:.|       .|..|:|....:|:
  Fly   901 SKDKDKEKNLKRNLNKDKDANKMD-DRPKWGVNRPVVQYVKASD-------RDPFCLRKKKNHPS 957

Human   907 MVK----------------NRDRQQAILKG----LSEL-RQGLLQKQKELESSLLPL 942
            ..|                ..||...|..|    ..|| .:|.|.|.:.:.:.:||:
  Fly   958 TAKPPRSLSMDSRLDSVALPEDRLINIAGGPPSAAGELEEEGFLLKARNVCTEILPI 1014

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCDC66NP_001340076.1 CCDC66 411..562 CDD:317619 37/140 (26%)
CG13251NP_649246.1 CCDC66 445..580 CDD:291889 37/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C333947892
eggNOG 1 0.900 E1_28UYI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22736
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.