DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rdh8a and CG31937

Sequence 1:NP_957001.1 Gene:rdh8a ZFINID:ZDB-GENE-021115-3 Length:318 Species:Danio rerio
Sequence 2:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster

Alignment Length:204 Identity:61/205 (30%)
Similarity:109/205 (53%) Gaps:15/205 (7%)


Zfish     1 MASGGGQKVVLITGCSSGIGLRIAVLLARDEQKRYHVIATMRDLKKKDRLVE-----AAGEVYGQ 60
            ::|..|| ||.|||.|||||..:|:.|||...|   ::.:.|.|::.:::.|     |.|.:..:
  Fly    41 LSSMRGQ-VVWITGASSGIGRALALSLARHGVK---LVLSARRLEQLEQVQEECLAAARGLLATK 101

Zfish    61 TLTLLPLDICSDESVRQCVNSVKD--RHIDVLINNAGVGLLGPVESISMDEMKRVFETNFFGTVR 123
            .:.::.:|:...:..:..:|:|.:  ..:|||:||||.........:.::..:.:||.:.|..|.
  Fly   102 DVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVH 166

Zfish   124 MIKEVMPDMKKRQA--GHIIIMSSVMGLQGVVFNDVYTASKFAIEGFCESMAVQLLKFNVKLSLI 186
            :.:.|:....::..  |||...||:.|...|.|:..|.|:|.|:..:..|:.|::.|.:|  ||.
  Fly   167 LSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLDV--SLF 229

Zfish   187 EPGPVHTEF 195
            .|||:.|:|
  Fly   230 APGPIATDF 238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rdh8aNP_957001.1 type1_17beta-HSD-like_SDR_c 8..265 CDD:187666 58/198 (29%)
adh_short 8..207 CDD:278532 58/198 (29%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 60/202 (30%)
adh_short 47..245 CDD:278532 59/199 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.