DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43980 and Abtb2

DIOPT Version :8

Sequence 1:NP_001262185.1 Gene:CG43980 / 2768995 FlyBaseID:FBgn0264711 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_849221.2 Gene:Abtb2 / 99382 MGIID:2139365 Length:1024 Species:Mus musculus

Alignment Length:1103 Identity:396/1104 (36%)
Similarity:593/1104 (54%) Gaps:187/1104 (17%)


  Fly   510 LEDIKL-----AMLTLRSQTSSSTYSSLSAGSESSEPARRL----------GRYSSLETVVTSTS 559
            |||:.|     |..:.||.:.||:.|:..|.:.|::..|..          .|::|.:||.|...
Mouse    12 LEDLTLDSGYGAGDSCRSLSLSSSKSNSQALNSSAQQHRGAAWWCYSGSMNSRHNSWDTVNTVLP 76

  Fly   560 ADEFVWVDSHN---RLVELQHPPWSQQCILKVLRNGRCQQQAEHLAVEAVSRLGYLLQRALVRIA 621
            .|..| .|..:   ||.||:..||::..:.:|||.....::....:.|||.||..||:|||:|:|
Mouse    77 EDPEV-ADLFSRCPRLPELEEFPWTEGDVARVLRKSVGGRRLPSFSAEAVRRLAGLLRRALIRVA 140

  Fly   622 REIQRFSAGVGLCSKQEVVGALRVVLSSSLADSCTKACLRSAAMFAVPGESALKQSKSARAGLQL 686
            ||.||.|.....|::.||..|:|:|.|.:||:||..|.:::.:::::.....|::.||||.||..
Mouse   141 REAQRLSVLHAKCTRFEVQSAVRLVHSWALAESCALAAVKALSLYSMSAGDGLRRGKSARCGLTF 205

  Fly   687 SVGRFYRWMTDARLGKFIHEYAAVYLCAGIENLLEEIALQC-------------NGTTAAALDQS 738
            |||||:|||.|.|:...||||||:.|.|.:|||:|||..:.             ...:|.||:..
Mouse   206 SVGRFFRWMVDTRISVRIHEYAAISLTACMENLVEEIRARVLASQSPDGGGAGGGEVSAEALEMV 270

  Fly   739 IASSGDVWGLLQPFAHLNAGRIASGALALPRWANSLDQVIASSGDFRGH---------------- 787
            |.:..::||:|||:.||..|:.|:|.|:||.:.:..      :|...||                
Mouse   271 INNDAELWGVLQPYEHLICGKNANGVLSLPAYFSPY------NGGSLGHDERADAYAQLELRTLE 329

  Fly   788 ---LATCVGSIRELKEKALRTQQEFQLAAAL-------------------SGSALAALFYFMRCS 830
               ||||||||.||.:...|.....|....|                   |..||..|:||:||.
Mouse   330 QSLLATCVGSISELSDLVSRAMHHMQGRHPLCPGTSPARQARQPPQPITWSPDALHTLYYFLRCP 394

  Fly   831 QLEHTELLAASGCHAGQAQSAAPGGGTSSAGHHVQELCYERAYVVLPPLAEWLRVAAAHAEHRNA 895
            |:|..|           ..:..|...|         |..||.:::||||.||:|||..:||||.:
Mouse   395 QMESME-----------NPNLDPPRMT---------LNNERPFMLLPPLMEWMRVAITYAEHRRS 439

  Fly   896 MMIDKDDVMQAARLLLPGVDCPIRPVAH----------DEELPTKKTHFNTAPTVSSTGTGTGSS 950
            ..:|..|:.|||||||||:||..|.:..          |....|::  ||               
Mouse   440 PTVDSGDIRQAARLLLPGLDCEPRQLKPECCFSSFRRLDARAATER--FN--------------- 487

  Fly   951 SCSSPVVSGIGIGIGEDTSELGRRATIGVAFKLLLTGRAELLAQAAQLLPPTTRYDTQNSAGLTA 1015
                              .:||        |::|..||.:|::||.:.|.| ...:|.:..|:|.
Mouse   488 ------------------QDLG--------FRMLNCGRTDLISQAIEALGP-DGVNTMDDQGMTP 525

  Fly  1016 LMIASIRNDEVALHALLDAGCDPNVEVPPAGSAGYPAIQPDTQHWTALSFAASRANYVALRILLE 1080
            ||.|....||..:..|:|||.:.:::| |:.|..:|::.||::|||:|:||....:...:::||:
Mouse   526 LMYACAAGDEAMVQMLIDAGANLDIQV-PSHSPRHPSVHPDSRHWTSLTFAVLHGHISVVQLLLD 589

  Fly  1081 RGGKVEGGA-RSSEEKCTLTPLQLAAGTGNLEIVALLLAHGANAFLSTQQKDSLCFAGSAQKGCF 1144
            .|..|||.| .|.|:....||||||:..||.|:|:|||:.||:..||..:.:.:..:...:..||
Mouse   590 AGAHVEGSAVNSGEDSYAETPLQLASAAGNYELVSLLLSRGADPLLSMLEANGMASSLHEEMNCF 654

  Fly  1145 CAISVAAAHGHRSCLRKLLTHPVSPGTRDVLSLEEMLAEG----DVGGVRGSGGPTGAGGPNSAS 1205
               |.:||||||:.||||||.| .....|||||||:||||    |......|.||.         
Mouse   655 ---SHSAAHGHRNVLRKLLTQP-QQAKADVLSLEEILAEGVEESDTSSQGSSEGPV--------- 706

  Fly  1206 ASGNNEDILPLLNKTQIKRLQEAMYHSAENNHLDITIELRKLGVPWTLHCWMHALSAAHDLRLDA 1270
                      .|::|:.|.||||||:|||:.:||||:|||.|||||.||.|:.:|..:......:
Mouse   707 ----------RLSRTRTKALQEAMYYSAEHGYLDITMELRALGVPWKLHIWIESLRTSFSQSRYS 761

  Fly  1271 VIDQLLQDFLQVCPDDYSAQFVSECLPLLFNIFR-NKNEGTTLLLADIFATCFGWETLPPVKEQP 1334
            |:..||:||..:..::|:.:.|:|.|.|:|:|.: :||:.....||.||..|:|...:|.:   |
Mouse   762 VVQSLLKDFSSIKEEEYNEELVTEGLQLMFDILKTSKNDSVLQQLATIFTHCYGTSPIPSI---P 823

  Fly  1335 PMQPVQGSRIDPKFVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLSSKL-SEGSSTPTVQ 1398
            .::....:|:||.|:||.|:|||||.||||:||.||::|||||.||::::::|. .:|.|:.|::
Mouse   824 EIRKTLPARLDPHFLNNKEMSDVTFLVEGKLFYAHKVLLVTASNRFKTLMTNKSEQDGDSSKTIE 888

  Fly  1399 INDIRYHIFQLVMQFLYCGGCSSLDVAHGDVLELMAAASFFQLEGLLRYTEARCSEMVDVDNVVA 1463
            |:||:|||||::||:||.||..|:::...|:|:|::||:.|||:.|.|:.|..||:.:.|::.|.
Mouse   889 ISDIKYHIFQMLMQYLYYGGTESMEIPTADILQLLSAANLFQLDALQRHCEILCSQTLSVESAVN 953

  Fly  1464 MYIHAKVYNANRLLEFCQCFLLQNMVALLTYDDSVKRLLFAK--KIPNHDVLAGLLQTLQNRL 1524
            .|.:||::||..|..||:.|.|::|.|||. .|:.::|::.:  |:...|.|..|..||..|:
Mouse   954 TYKYAKIHNAPELALFCEGFFLKHMKALLE-QDAFRQLIYGRSSKVQGLDPLQDLQSTLAERV 1015

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43980NP_001262185.1 Med25_SD1 265..424 CDD:288132
H2A 675..>728 CDD:305064 30/66 (45%)
ANK 1006..1163 CDD:238125 63/158 (40%)
ANK repeat 1012..1056 CDD:293786 16/44 (36%)
Ank_2 1016..1122 CDD:289560 45/107 (42%)
ANK repeat 1058..1091 CDD:293786 13/34 (38%)
ANK repeat 1093..1121 CDD:293786 15/28 (54%)
ANK repeat 1141..1173 CDD:293786 16/32 (50%)
BTB 1350..1446 CDD:279045 51/97 (53%)
BTB 1356..1449 CDD:197585 48/94 (51%)
SPOP_C_like 1456..>1492 CDD:269810 15/36 (42%)
Abtb2NP_849221.2 H2A 194..>242 CDD:305064 29/48 (60%)
Ank_4 <498..542 CDD:290365 16/45 (36%)
ANK 516..670 CDD:238125 63/158 (40%)
ANK 1 521..550 11/29 (38%)
ANK repeat 524..565 CDD:293786 15/42 (36%)
Ank_2 526..633 CDD:289560 45/108 (42%)
ANK repeat 567..604 CDD:293786 15/37 (41%)
ANK 2 567..596 11/29 (38%)
ANK 3 606..635 15/29 (52%)
ANK repeat 606..631 CDD:293786 14/25 (56%)
Ank_2 611..>679 CDD:289560 31/72 (43%)
ANK repeat 649..679 CDD:293786 16/34 (47%)
ANK 4 649..678 16/33 (48%)
BTB 836..939 CDD:279045 53/103 (51%)
BTB 845..946 CDD:197585 51/101 (50%)
SPOP_C_like 946..>990 CDD:269810 17/45 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KA7
Hieranoid 1 1.000
Homologene 1 1.000 H15904
Inparanoid 1 1.050 597 1.000 Inparanoid score I943
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002291
OrthoInspector 1 1.000 T615465
orthoMCL 1 0.900 OOG5_132131
Panther 1 1.100 LDO PTHR46071
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5139
TreeFam 1 0.960
1211.860

Return to query results.
Submit another query.