DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43980 and Btbd11

DIOPT Version :8

Sequence 1:NP_001262185.1 Gene:CG43980 / 2768995 FlyBaseID:FBgn0264711 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_082985.2 Gene:Btbd11 / 74007 MGIID:1921257 Length:1109 Species:Mus musculus

Alignment Length:1203 Identity:408/1204 (34%)
Similarity:587/1204 (49%) Gaps:266/1204 (22%)


  Fly   501 GKAPWSGTGLEDIKLAMLTLRS----QTSSSTYSSLSAGSESSEPARRLG-------------RY 548
            ||.|...| |||     |||.|    ...|...|:||.....|.||...|             |:
Mouse     5 GKKPVVRT-LED-----LTLDSGYGGAADSVRSSNLSLCCSDSHPASPYGGSCWPPLADSMHSRH 63

  Fly   549 SSLETVVTSTSADE--FVWVDSH-NRLV-ELQHPPWSQQCILKVLRNGRCQQQAE----HLAVEA 605
            :|.:||.|:...|.  ......| :||: :|...||:.|.:..:|...|..:...    .|..:|
Mouse    64 NSFDTVNTALVEDSEGLDCAGQHCSRLLPDLDEVPWTLQELELLLLRSRDPRAGPAVPGSLPKDA 128

  Fly   606 VSRLGYLLQRALVRIAREIQRFSAGVGLCSKQEVVGALRVVLSSSLADSCTKACLRSAAMF--AV 668
            :::|..|:.|||||||:|.||.|.....|:|.|:..|:.:|||..||..||.|.|.:.:::  :.
Mouse   129 LAKLSMLVSRALVRIAKEAQRLSLRFAKCTKYEIQSAMEIVLSWGLAAHCTAAALAALSLYNMSS 193

  Fly   669 PGESALKQSKSARAGLQLSVGRFYRWMTDARLGKFIHEYAAVYLCAGIENLLEEI---------A 724
            .|...|.:.||||.||..||||.||||.|:|:...|||:||:||.|.:|:|..:|         .
Mouse   194 AGGDRLGRGKSARCGLTFSVGRVYRWMVDSRVALRIHEHAAIYLTACMESLFRDIYSRVLASGLP 258

  Fly   725 LQCNG------------------------------------------------------------ 729
            ..|:|                                                            
Mouse   259 RSCSGPGPGSSSGSGPGPGSGPGAPAADKERETPGGGAASGGPCSAASSASGGSSCCAPPATAAT 323

  Fly   730 ----TTAAA-----------------------LDQSIASSGDVWGLLQPFAHLNAGRIASGALAL 767
                |||.|                       |:.::.:..::||||||:.||..|:.|||.|:|
Mouse   324 AVPPTTATAAVAANHHHHHHTLHEAPKFTVETLEHTVNNDSEIWGLLQPYQHLICGKNASGVLSL 388

  Fly   768 PRWAN-----------------------SLDQVIASSGDFRGHLATCVGSIRELKEKALRTQQEF 809
            |...|                       :::|.:         |||.||||.||.:...|.....
Mouse   389 PESLNLHRDPQRPSKPGELPMFSQSELRTIEQSL---------LATRVGSIAELSDLVSRAMHHL 444

  Fly   810 Q-LAAALSGS----------------ALAALFYFMRCSQLEHTELLAASGCHAGQAQSAAPGGGT 857
            | |.|...|:                ||..|.|||.|.|:|...                |....
Mouse   445 QPLNAKHHGNGTPMHHKQGALYWEPEALYTLCYFMHCPQMEWEN----------------PNVEP 493

  Fly   858 SSAGHHVQELCYERAYVVLPPLAEWLRVAAAHAEHRNAMMIDKDDVMQAARLLLPGVDCPIRPVA 922
            |.....|     ||.::|||||.||:|||.|||.||.:..:|.|||.||||||||||||..|.:.
Mouse   494 SKVNLQV-----ERPFLVLPPLMEWIRVAVAHAGHRRSFSMDSDDVRQAARLLLPGVDCEPRQLK 553

  Fly   923 HDEELPTKKTHFNTAPTVSSTGTGTGSSSCSSPVVSGIGIGIGEDTSELGRRATIGVAFKLLLTG 987
            .|:                        ..|:|..:..:.|       |...:..:|  |::|..|
Mouse   554 ADD------------------------CFCASRKLDAVAI-------EAKFKQDLG--FRMLNCG 585

  Fly   988 RAELLAQAAQLLPPTTRYDTQNSAGLTALMIASIRNDEVALHALLDAGCDPNVEVPPAGSAGYPA 1052
            |.:|:.||..||.| ...:|.:..|:|.||.|.:|.||..:..|||||.|.||||...... ||:
Mouse   586 RTDLVKQAVSLLGP-DGINTMSEQGMTPLMYACVRGDEAMVQMLLDAGADLNVEVVSTPHK-YPS 648

  Fly  1053 IQPDTQHWTALSFAASRANYVALRILLERGGKVEGGARSSEEKCTLTPLQLAAGTGNLEIVALLL 1117
            :.|:|:|||||:||....:...:::||:.|.||||.....||..:.|||||||..||.|:|:|||
Mouse   649 VHPETRHWTALTFAVLHGHIPVVQLLLDAGAKVEGSVEHGEENYSETPLQLAAAVGNFELVSLLL 713

  Fly  1118 AHGANAFLSTQQKDSLCFAGSAQKGCFCAISVAAAHGHRSCLRKLLTHPVSPGTRDVLSLEEMLA 1182
            ..||:..:.|..::.:   .:..:|...:.|.|||||||:..||||..|....: |:|||||:||
Mouse   714 ERGADPLIGTMYRNGI---STTPQGDMNSFSQAAAHGHRNVFRKLLAQPEKEKS-DILSLEEILA 774

  Fly  1183 EG-DVGGVRGSGGPTGAGGPNSASASGNNEDILPLLNKTQIKRLQEAMYHSAENNHLDITIELRK 1246
            || |:...          .|....||.|        :|.:::.|:||||||||:.::|:||::|.
Mouse   775 EGTDLAET----------APPPLCASRN--------SKAKLRALREAMYHSAEHGYVDVTIDIRS 821

  Fly  1247 LGVPWTLHCWMHALSAAHDLRLDAVIDQLLQDFLQVCPDDYSAQFVSECLPLLFNIFR-NKNEGT 1310
            :|||||||.|:.:|..|.......:|..||::|..:..::|:.:.|::.|||:|.|.: :|||..
Mouse   822 IGVPWTLHTWLESLRIAFQQHRRPLIQCLLKEFKTIQEEEYTEELVTQGLPLMFEILKASKNEVI 886

  Fly  1311 TLLLADIFATCFGWETLPPVKEQPPMQPVQGSRIDPKFVNNPELSDVTFRVEGKIFYGHKIVLVT 1375
            :..|..||..|:|...:|.:.|   ::..|.||:||.|:||.|:|||||.|||:.||.||::|.|
Mouse   887 SQQLCVIFTHCYGPYPIPKLTE---IKRKQTSRLDPHFLNNKEMSDVTFLVEGRPFYAHKVLLFT 948

  Fly  1376 ASPRFQSMLSSKLSEGSSTPTVQINDIRYHIFQLVMQFLYCGGCSSLDVAHGDVLELMAAASFFQ 1440
            |||||:::||||.:..::  .::|..::|.|||||||:||.||..||.:.:.:::||::||.|||
Mouse   949 ASPRFKALLSSKPTNDNT--CIEIGYVKYPIFQLVMQYLYYGGPESLLIKNNEIMELLSAAKFFQ 1011

  Fly  1441 LEGLLRYTEARCSEMVDVDNVVAMYIHAKVYNANRLLEFCQCFLLQNMVALLTYDDSVKRLLFAK 1505
            ||.|.|:.|..|::.::.||.|.:|.|||......|..:|:.:.|:||:.|:. :::.|:||:.|
Mouse  1012 LEALQRHCEIICAKSINTDNCVDIYSHAKFLGVTELSAYCEGYFLKNMMVLIE-NEAFKQLLYDK 1075

  Fly  1506 --KIPNHDVLAGLLQTLQNRLKARKPNSGGGLV 1536
              :....|||..|.:||..|:::...:|..|.|
Mouse  1076 NGEGAGQDVLQDLQRTLAIRIQSIHLSSSKGSV 1108

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43980NP_001262185.1 Med25_SD1 265..424 CDD:288132
H2A 675..>728 CDD:305064 28/62 (45%)
ANK 1006..1163 CDD:238125 68/157 (43%)
ANK repeat 1012..1056 CDD:293786 21/44 (48%)
Ank_2 1016..1122 CDD:289560 52/106 (49%)
ANK repeat 1058..1091 CDD:293786 14/33 (42%)
ANK repeat 1093..1121 CDD:293786 17/28 (61%)
ANK repeat 1141..1173 CDD:293786 14/32 (44%)
BTB 1350..1446 CDD:279045 51/96 (53%)
BTB 1356..1449 CDD:197585 48/93 (52%)
SPOP_C_like 1456..>1492 CDD:269810 13/36 (36%)
Btbd11NP_082985.2 H2A 200..>244 CDD:305064 25/44 (57%)
Ank_4 <585..629 CDD:290365 18/45 (40%)
ANK 603..756 CDD:238125 68/157 (43%)
ANK 1 608..637 15/29 (52%)
ANK repeat 611..652 CDD:293786 20/42 (48%)
Ank_2 613..721 CDD:289560 52/109 (48%)
ANK repeat 654..685 CDD:293786 14/31 (45%)
ANK 2 654..683 13/29 (45%)
ANK repeat 687..717 CDD:293786 17/30 (57%)
ANK 3 692..721 16/29 (55%)
Ank_2 697..>757 CDD:289560 28/63 (44%)
ANK 4 735..764 14/29 (48%)
ANK 5 830..859 7/29 (24%)
BTB 920..1023 CDD:279045 54/105 (51%)
BTB 929..1027 CDD:197585 50/100 (50%)
BACK_like 1027..>1071 CDD:297737 14/45 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KA7
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 597 1.000 Inparanoid score I943
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D201821at33208
OrthoFinder 1 1.000 FOG0002291
OrthoInspector 1 1.000 T615465
orthoMCL 1 0.900 OOG5_132131
Panther 1 1.100 O PTHR46071
Phylome 1 0.910 0.823 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5139
TreeFam 1 0.960
1211.870

Return to query results.
Submit another query.