DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43980 and Btbd11

DIOPT Version :8

Sequence 1:NP_001262185.1 Gene:CG43980 / 2768995 FlyBaseID:FBgn0264711 Length:1549 Species:Drosophila melanogaster
Sequence 2:XP_017458824.1 Gene:Btbd11 / 314675 RGDID:1308647 Length:1070 Species:Rattus norvegicus

Alignment Length:1164 Identity:408/1165 (35%)
Similarity:585/1165 (50%) Gaps:227/1165 (19%)


  Fly   501 GKAPWSGTGLEDIKLAMLTLRS----QTSSSTYSSLSAGSESSEPARRLG-------------RY 548
            ||.|...| |||     |||.|    ...|...|:||.....|.||...|             |:
  Rat     5 GKKPVVRT-LED-----LTLDSGYGGAADSVRSSNLSLCCSDSHPASPYGGSCWPPLADSMHSRH 63

  Fly   549 SSLETVVTSTSADE--FVWVDSH-NRLV-ELQHPPWSQQ---CILKVLRNGRCQQQAE-HLAVEA 605
            :|.:||.|:...|.  ......| :||: :|...||:.|   .:|...|:.|....|. .|..:|
  Rat    64 NSFDTVNTALVEDSEGLDCAGQHCSRLLPDLDEVPWTLQELELLLLRSRDPRAGPAAPGSLPKDA 128

  Fly   606 VSRLGYLLQRALVRIAREIQRFSAGVGLCSKQEVVGALRVVLSSSLADSCTKACLRSAAMF--AV 668
            :::|..|:.|||||||:|.||.|.....|:|.||..|:.:|||..||..||.|.|.:.:::  :.
  Rat   129 LAKLSMLVSRALVRIAKEAQRLSLRFAKCTKYEVQSAMEIVLSWGLAARCTAAALAALSLYNMSS 193

  Fly   669 PGESALKQSKSARAGLQLSVGRFYRWMTDARLGKFIHEYAAVYLCAGIENLLEEIALQ------- 726
            .|...|.:.||||.||..||||.||||.|:|:...|||:||:||.|.:|:|..:|..:       
  Rat   194 AGGDRLGRGKSARCGLTFSVGRVYRWMVDSRVALRIHEHAAIYLTACMESLFRDIYTRVLASGLP 258

  Fly   727 --CNGT-------------------------------------------TAAALDQSIASSGDVW 746
              |:|.                                           |...|:.::.:..::|
  Rat   259 RSCSGPGPGSSSSSGPGPGSGPGAPTADKERETPGGGAASDTLHEAPKFTVETLEHTVNNDSEIW 323

  Fly   747 GLLQPFAHLNAGRIASGALALPRWAN-----------------------SLDQVIASSGDFRGHL 788
            |||||:.||..|:.|||.|:||...|                       :::|.:         |
  Rat   324 GLLQPYQHLICGKNASGVLSLPESLNLHRDPQRPSKPGELPMFSQSELRTIEQSL---------L 379

  Fly   789 ATCVGSIRELKEKALRTQQEFQ-LAAALSGS----------------ALAALFYFMRCSQLEHTE 836
            ||.||||.||.:...|.....| |.....|:                ||..|.|||.|.|:|...
  Rat   380 ATRVGSIAELSDLVSRAMHHLQPLNVKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQMEWEN 444

  Fly   837 LLAASGCHAGQAQSAAPGGGTSSAGHHVQELCYERAYVVLPPLAEWLRVAAAHAEHRNAMMIDKD 901
                            |....|.....|     ||.::|||||.||:|||.|||.||.:..:|.|
  Rat   445 ----------------PNVEPSKVNLQV-----ERPFLVLPPLMEWIRVAVAHAGHRRSFSMDSD 488

  Fly   902 DVMQAARLLLPGVDCPIRPVAHDEELPTKKTHFNTAPTVSSTGTGTGSSSCSSPVVSGIGIGIGE 966
            ||.||||||||||||..|.:..|:                        ..|:|..:..:.|    
  Rat   489 DVRQAARLLLPGVDCEPRQLKADD------------------------CFCASRKLDAVAI---- 525

  Fly   967 DTSELGRRATIGVAFKLLLTGRAELLAQAAQLLPPTTRYDTQNSAGLTALMIASIRNDEVALHAL 1031
               |...:..:|  |::|..||.:|:.||..||.| ...:|.:..|:|.||.|.:|.||..:..|
  Rat   526 ---EAKFKQDLG--FRMLNCGRTDLVKQAVSLLGP-DGINTMSEQGMTPLMYACVRGDEAMVQML 584

  Fly  1032 LDAGCDPNVEVPPAGSAGYPAIQPDTQHWTALSFAASRANYVALRILLERGGKVEGGARSSEEKC 1096
            ||||.|.|||| .:....||::.|:|:|||||:||....:...:::||:.|.||||.....||..
  Rat   585 LDAGADLNVEV-VSSPHKYPSVHPETRHWTALTFAVLHGHIPVVQLLLDAGAKVEGSVEHGEENY 648

  Fly  1097 TLTPLQLAAGTGNLEIVALLLAHGANAFLSTQQKDSLCFAGSAQKGCFCAISVAAAHGHRSCLRK 1161
            :.|||||||..||.|:|:|||..||:..:.|..::.:   .:..:|...:.|.|||||||:..||
  Rat   649 SETPLQLAAAVGNFELVSLLLERGADPLIGTMYRNGI---STTPQGDMNSFSQAAAHGHRNVFRK 710

  Fly  1162 LLTHPVSPGTRDVLSLEEMLAEG-DVGGVRGSGGPTGAGGPNSASASGNNEDILPLLNKTQIKRL 1225
            ||..|....: |:|||||:|||| |:...          .|....||.|        :|.:::.|
  Rat   711 LLAQPEKEKS-DILSLEEILAEGTDLAET----------APPPLCASRN--------SKAKLRAL 756

  Fly  1226 QEAMYHSAENNHLDITIELRKLGV-----PWTLHCWMHALSAAHDLRLDAVIDQLLQDFLQVCPD 1285
            :||||||||:.::|:||::|.:.:     |||||.|:.:|..|.......:|..||::|..:..:
  Rat   757 REAMYHSAEHGYVDVTIDIRSIVIVXVRPPWTLHTWLESLRIAFQQHRRPLIQCLLKEFKTIQEE 821

  Fly  1286 DYSAQFVSECLPLLFNIFR-NKNEGTTLLLADIFATCFGWETLPPVKEQPPMQPVQGSRIDPKFV 1349
            :|:.:.|::.|||:|.|.: :|||..:..|..||..|:|...:|.:.|   ::..|.||:||.|:
  Rat   822 EYTEELVTQGLPLMFEILKASKNEVISQQLCVIFTHCYGPYPIPKLTE---IKRKQTSRLDPHFL 883

  Fly  1350 NNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLSSKLSEGSSTPTVQINDIRYHIFQLVMQFL 1414
            ||.|:|||||.|||:.||.||::|.||||||:::||||.:..|:  .|:|..::|.|||||||:|
  Rat   884 NNKEMSDVTFLVEGRPFYAHKVLLFTASPRFKALLSSKPTNDST--CVEIGYVKYPIFQLVMQYL 946

  Fly  1415 YCGGCSSLDVAHGDVLELMAAASFFQLEGLLRYTEARCSEMVDVDNVVAMYIHAKVYNANRLLEF 1479
            |.||..||.:.:.:::||::||.|||||.|.|:.|..|::.|:.||.|.:|.|||......|..:
  Rat   947 YYGGPESLLIKNNEIMELLSAAKFFQLEALQRHCEIICAKSVNTDNCVDIYSHAKFLGVTELSAY 1011

  Fly  1480 CQCFLLQNMVALLTYDDSVKRLLFAK--KIPNHDVLAGLLQTLQNRLKARKPNSGGGLV 1536
            |:.:.|:||:.|:. :::.|:||:.|  :....|||..|.:||..|:::...:|..|.|
  Rat  1012 CEGYFLKNMMVLIE-NEAFKQLLYDKNGEGTGQDVLQDLQRTLAIRIQSIHLSSSKGSV 1069

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43980NP_001262185.1 Med25_SD1 265..424 CDD:288132
H2A 675..>728 CDD:305064 28/62 (45%)
ANK 1006..1163 CDD:238125 68/157 (43%)
ANK repeat 1012..1056 CDD:293786 21/44 (48%)
Ank_2 1016..1122 CDD:289560 52/106 (49%)
ANK repeat 1058..1091 CDD:293786 14/33 (42%)
ANK repeat 1093..1121 CDD:293786 17/28 (61%)
ANK repeat 1141..1173 CDD:293786 14/32 (44%)
BTB 1350..1446 CDD:279045 53/96 (55%)
BTB 1356..1449 CDD:197585 50/93 (54%)
SPOP_C_like 1456..>1492 CDD:269810 14/36 (39%)
Btbd11XP_017458824.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201821at33208
OrthoFinder 1 1.000 FOG0002291
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46071
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.