DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43980 and Abtb2

DIOPT Version :8

Sequence 1:NP_001262185.1 Gene:CG43980 / 2768995 FlyBaseID:FBgn0264711 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_599230.2 Gene:Abtb2 / 171440 RGDID:620724 Length:1024 Species:Rattus norvegicus

Alignment Length:1104 Identity:397/1105 (36%)
Similarity:592/1105 (54%) Gaps:189/1105 (17%)


  Fly   510 LEDIKL-----AMLTLRSQTSSSTYSSLSAGSESSEPARR-----------LGRYSSLETVVTST 558
            |||:.|     |..:.||.:.||:.|: |....||.|..|           ..|::|.:||.|..
  Rat    12 LEDLTLDSGYGAGDSCRSLSLSSSKSN-SQALNSSAPQHRGAAWWCYSGSMNSRHNSWDTVNTVL 75

  Fly   559 SADEFVWVDSHN---RLVELQHPPWSQQCILKVLRNGRCQQQAEHLAVEAVSRLGYLLQRALVRI 620
            ..|..| .|..:   ||.||:..||::..:.:|||.....::....:.|||.||..||:|||:|:
  Rat    76 PEDPEV-ADLFSRCPRLPELEEFPWTEGDVARVLRKSVGGRRLPSFSAEAVRRLAGLLRRALIRV 139

  Fly   621 AREIQRFSAGVGLCSKQEVVGALRVVLSSSLADSCTKACLRSAAMFAVPGESALKQSKSARAGLQ 685
            |||.||.|.....|::.||..|:|:|.|.:||:||..|.:::.:::::.....|::.||||.||.
  Rat   140 AREAQRLSVLHAKCTRFEVQSAVRLVHSWALAESCALAAVKALSLYSMSAGDGLRRGKSARCGLT 204

  Fly   686 LSVGRFYRWMTDARLGKFIHEYAAVYLCAGIENLLEEIALQC-------------NGTTAAALDQ 737
            .|||||:|||.|.|:...||||||:.|.|.:|||:|||..:.             ...:|.||:.
  Rat   205 FSVGRFFRWMVDTRISVRIHEYAAISLTACMENLVEEIRARVLASQSPDGGGAGGGEVSAEALEM 269

  Fly   738 SIASSGDVWGLLQPFAHLNAGRIASGALALPRWANSLDQVIASSGDFRGH--------------- 787
            .|.:..::||:|||:.||..|:.|:|.|:||.:.:..      :|...||               
  Rat   270 VINNDAELWGVLQPYEHLICGKNANGVLSLPAYFSPY------NGGSLGHDERADAYAQLELRTL 328

  Fly   788 ----LATCVGSIRELKEKALRTQQEFQLAAAL-------------------SGSALAALFYFMRC 829
                ||||||||.||.:...|.....|....|                   |..||..|:||:||
  Rat   329 EQSLLATCVGSISELSDLVSRAMHHMQGRHPLCPGTSPARQARQPPQPITWSPDALHTLYYFLRC 393

  Fly   830 SQLEHTELLAASGCHAGQAQSAAPGGGTSSAGHHVQELCYERAYVVLPPLAEWLRVAAAHAEHRN 894
            .|:|..|           ..:..|...|         |..||.:::||||.||:|||..:||||.
  Rat   394 PQMESME-----------NPNLDPPRMT---------LNNERPFMLLPPLMEWMRVAITYAEHRR 438

  Fly   895 AMMIDKDDVMQAARLLLPGVDCPIRPVAH----------DEELPTKKTHFNTAPTVSSTGTGTGS 949
            ::.:|..|:.|||||||||:||..|.:..          |....|::  ||              
  Rat   439 SLTVDSGDIRQAARLLLPGLDCEPRQLKPECCFSSFRRLDARAATER--FN-------------- 487

  Fly   950 SSCSSPVVSGIGIGIGEDTSELGRRATIGVAFKLLLTGRAELLAQAAQLLPPTTRYDTQNSAGLT 1014
                               .:||        |::|..||.:|::||.:.|.| ...:|.:..|||
  Rat   488 -------------------QDLG--------FRMLNCGRTDLISQAIEALGP-DGVNTMDDQGLT 524

  Fly  1015 ALMIASIRNDEVALHALLDAGCDPNVEVPPAGSAGYPAIQPDTQHWTALSFAASRANYVALRILL 1079
            .||.|....||..:..|:|||.:.:::| |:.|..:|::.||::|||:|:||....:...:::||
  Rat   525 PLMYACATGDEAMVQMLIDAGANLDIQV-PSNSPRHPSVHPDSRHWTSLTFAVLHGHISVVQLLL 588

  Fly  1080 ERGGKVEGGA-RSSEEKCTLTPLQLAAGTGNLEIVALLLAHGANAFLSTQQKDSLCFAGSAQKGC 1143
            :.|..|||.| .|.|:....||||||:..||.|:|:|||:.||:..||..:.:.:..:......|
  Rat   589 DAGAHVEGSAVNSGEDSYAETPLQLASAAGNYELVSLLLSRGADPLLSMLEANGMASSLHEDMNC 653

  Fly  1144 FCAISVAAAHGHRSCLRKLLTHPVSPGTRDVLSLEEMLAEG----DVGGVRGSGGPTGAGGPNSA 1204
            |   |.:||||||:.||||||.| .....|||||||:||||    |......|.||.        
  Rat   654 F---SHSAAHGHRNVLRKLLTQP-QQAKADVLSLEEILAEGVEESDTSSQGSSEGPV-------- 706

  Fly  1205 SASGNNEDILPLLNKTQIKRLQEAMYHSAENNHLDITIELRKLGVPWTLHCWMHALSAAHDLRLD 1269
                       .|::|:.|.||||||:|||:.::|||:|||.|||||.||.|:.:|..:......
  Rat   707 -----------RLSRTRTKALQEAMYYSAEHGYVDITMELRALGVPWKLHIWIESLRTSFSQSRY 760

  Fly  1270 AVIDQLLQDFLQVCPDDYSAQFVSECLPLLFNIFR-NKNEGTTLLLADIFATCFGWETLPPVKEQ 1333
            :|:..||:||..:..::|:.:.|:|.|.|:|:|.: :||:.....||.||..|:|...:|.:   
  Rat   761 SVVQGLLRDFSSIKEEEYNEELVTEGLQLMFDILKTSKNDSVLQQLATIFTHCYGTSPIPSI--- 822

  Fly  1334 PPMQPVQGSRIDPKFVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLSSKL-SEGSSTPTV 1397
            |.::....:|:||.|:||.|:|||||.||||:||.||::|||||.||::::::|. .:|.::.|:
  Rat   823 PEIRKTLPARLDPHFLNNKEMSDVTFLVEGKLFYAHKVLLVTASNRFKTLMTNKSEQDGDNSKTI 887

  Fly  1398 QINDIRYHIFQLVMQFLYCGGCSSLDVAHGDVLELMAAASFFQLEGLLRYTEARCSEMVDVDNVV 1462
            :|:||:|||||::||:||.||..|:::...|:|:|::||:.|||:.|.|:.|..||:.:.|::.|
  Rat   888 EISDIKYHIFQMLMQYLYYGGTESMEIPTADILQLLSAANLFQLDALQRHCEILCSQTLSVESAV 952

  Fly  1463 AMYIHAKVYNANRLLEFCQCFLLQNMVALLTYDDSVKRLLFAK--KIPNHDVLAGLLQTLQNRL 1524
            ..|.:||::||..|..||:.|.|::|.|||. .|:.::|::.:  |:...|.|..|..||..|:
  Rat   953 NTYKYAKIHNAPELALFCEGFFLKHMKALLE-QDAFRQLIYGRSSKVQGLDPLQDLQSTLAERV 1015

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43980NP_001262185.1 Med25_SD1 265..424 CDD:288132
H2A 675..>728 CDD:305064 30/66 (45%)
ANK 1006..1163 CDD:238125 64/158 (41%)
ANK repeat 1012..1056 CDD:293786 17/44 (39%)
Ank_2 1016..1122 CDD:289560 45/107 (42%)
ANK repeat 1058..1091 CDD:293786 13/34 (38%)
ANK repeat 1093..1121 CDD:293786 15/28 (54%)
ANK repeat 1141..1173 CDD:293786 16/32 (50%)
BTB 1350..1446 CDD:279045 50/97 (52%)
BTB 1356..1449 CDD:197585 47/94 (50%)
SPOP_C_like 1456..>1492 CDD:269810 15/36 (42%)
Abtb2NP_599230.2 H2A 194..>242 CDD:305064 29/48 (60%)
Ank_4 <498..542 CDD:290365 17/45 (38%)
ANK 516..670 CDD:238125 64/158 (41%)
ANK 1 521..550 12/29 (41%)
ANK repeat 522..565 CDD:293786 17/44 (39%)
Ank_2 526..633 CDD:289560 45/108 (42%)
ANK repeat 567..604 CDD:293786 15/37 (41%)
ANK 2 567..596 11/29 (38%)
ANK 3 606..635 15/29 (52%)
ANK repeat 606..631 CDD:293786 14/25 (56%)
Ank_2 611..>679 CDD:289560 31/72 (43%)
ANK 4 649..678 16/33 (48%)
BTB 836..939 CDD:279045 52/103 (50%)
BTB 845..946 CDD:197585 50/101 (50%)
SPOP_C_like 946..>990 CDD:269810 17/45 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H15904
Inparanoid 1 1.050 583 1.000 Inparanoid score I959
OMA 1 1.010
OrthoDB 1 1.010 D201821at33208
OrthoFinder 1 1.000 FOG0002291
OrthoInspector 1 1.000 T617573
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46071
Phylome 1 0.910 0.600 Consistency score
TreeFam 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.