DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33493 and DptB

Sequence 1:NP_996038.1 Gene:CG33493 FlyBaseID:FBgn0053493 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_523787.2 Gene:DptB FlyBaseID:FBgn0034407 Length:120 Species:Drosophila melanogaster

Alignment Length:68 Identity:19/69 (28%)
Similarity:27/69 (39%) Gaps:6/69 (9%)


  Fly    21 VP--RQRRQIDLTVSAEHDDNDEETELALEAIAGLWSSADSRTKIDGSASLVHRTHGTQSGTGST 83
            ||  |.|||..|. ........:..:|:|...|.:|.|.:.|...|.:.|......|..   |::
  Fly    46 VPLHRVRRQFQLN-GGGGGSPKQGFDLSLNGRAPVWQSPNGRHSFDATGSYAQHLGGPY---GNS 106

  Fly    84 RYQ 86
            |.|
  Fly   107 RPQ 109

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33493NP_996038.1 None
DptBNP_523787.2 Attacin_C <70..120 CDD:281726 12/44 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR38333
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.