DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and AT4G14330

DIOPT Version :10

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_567426.1 Gene:AT4G14330 / 827075 AraportID:AT4G14330 Length:869 Species:Arabidopsis thaliana


Alignment Length:118 Identity:29/118 - (24%)
Similarity:43/118 - (36%) Gaps:25/118 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RQPQKKSNQN--------------------IQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRH 54
            |.||.|...|                    ::|..|:|....|:.  :|..::.|....:.| |.
plant    19 RTPQTKQRLNFHSKTPNPDGSKDPSPPEHPVEVIGRIRDYPDRKE--KSPSILQVNTDNQTV-RV 80

  Fly    55 TLDSKLTKKFTFDR-SFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTG 106
            ..|... :.||.|. ||..:....:.|...:...|:.|..|..||:..||.||
plant    81 RADVGY-RDFTLDGVSFSEQEGLEEFYKKFIEERIKGVKVGNKCTIMMYGPTG 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:473979 23/109 (21%)
GINS_B_Psf1 115..163 CDD:412032
AT4G14330NP_567426.1 KISc 48..373 CDD:214526 24/89 (27%)
SMC_prok_B <403..556 CDD:274008
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.