DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and kif11

DIOPT Version :10

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001016116.2 Gene:kif11 / 548870 XenbaseID:XB-GENE-978999 Length:1067 Species:Xenopus tropicalis


Alignment Length:102 Identity:52/102 - (50%)
Similarity:67/102 - (65%) Gaps:5/102 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TSRQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHT--LDSKLTKK-FTFDRS 69
            :|::..|  .:||||.||.||.|..||...|..|::...||:.|...|  ::.||.|| :|||..
 Frog     9 SSKKDDK--GKNIQVVVRCRPFNQLERKASSHSVLECDAPRKEVCVRTGGINDKLGKKTYTFDMV 71

  Fly    70 FGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTG 106
            |||.:||.|||..||.|:::||:.|||||||||||||
 Frog    72 FGPAAKQIDVYRSVVCPILDEVIMGYNCTVFAYGQTG 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:473979 48/91 (53%)
GINS_B_Psf1 115..163 CDD:412032
kif11NP_001016116.2 KISc_BimC_Eg5 16..368 CDD:276815 50/93 (54%)
SMC_prok_B 376..>635 CDD:274008
sbcc 406..>915 CDD:129705
Microtub_bind 927..1066 CDD:464048
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1048..1067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.