DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and cmet

DIOPT Version :10

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_524993.3 Gene:cmet / 53561 FlyBaseID:FBgn0040232 Length:2189 Species:Drosophila melanogaster


Alignment Length:93 Identity:26/93 - (27%)
Similarity:44/93 - (47%) Gaps:9/93 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKKFTFDRSFGPESKQCDV 79
            |:..:|||.::|||      |......:..|..|..:  |..||. .:.:.||..|...:...:|
  Fly     4 KNASSIQVCIKVRP------CEPGLTSLWQVKERRSI--HLADSH-AEPYVFDYVFDEGASNQEV 59

  Fly    80 YSVVVSPLIEEVLNGYNCTVFAYGQTGN 107
            :..:...::...:.|:|.|:||||||.:
  Fly    60 FDRMAKHIVHACMQGFNGTIFAYGQTSS 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:473979 24/88 (27%)
GINS_B_Psf1 115..163 CDD:412032
cmetNP_524993.3 Motor_domain 8..321 CDD:473979 25/89 (28%)
SMC_prok_B 539..1431 CDD:274008
SMC_prok_B 1137..1926 CDD:274008
YhaN 1717..2182 CDD:443752
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.