DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and Klp59C

DIOPT Version :10

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_611759.1 Gene:Klp59C / 37671 FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster


Alignment Length:117 Identity:36/117 - (30%)
Similarity:51/117 - (43%) Gaps:21/117 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISGGNTSRQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKK---- 63
            :..|.|:   ::.:...|.|.||.|||..:|...|..:||      .:.::|||.....:|    
  Fly   174 VRSGTTN---ERINCHQIMVCVRKRPLRRKELADREQDVV------SIPSKHTLVVHEPRKHVNL 229

  Fly    64 --------FTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGN 107
                    |.||..|..|.....||.....|||:.:.:|...|.|||||||:
  Fly   230 VKFLENHSFRFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:473979 32/100 (32%)
GINS_B_Psf1 115..163 CDD:412032
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 34/101 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.