DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and Khc

DIOPT Version :10

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_476590.1 Gene:Khc / 36810 FlyBaseID:FBgn0001308 Length:975 Species:Drosophila melanogaster


Alignment Length:155 Identity:45/155 - (29%)
Similarity:64/155 - (41%) Gaps:30/155 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SRQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKKFTFDRSFGPE 73
            |.:.:..:..:|:|..|.||||..|....|..||..  |..|  .....|...|.:.||:.|.|.
  Fly     2 SAEREIPAEDSIKVVCRFRPLNDSEEKAGSKFVVKF--PNNV--EENCISIAGKVYLFDKVFKPN 62

  Fly    74 SKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGNNLRPPKSLYIEVRCMEDYGKFELDDGEVIHL 138
            :.|..||:.....::.:||.|||.|:||||||.:                  ||....:|.:...
  Fly    63 ASQEKVYNEAAKSIVTDVLAGYNGTIFAYGQTSS------------------GKTHTMEGVIGDS 109

  Fly   139 KKNSQHYLPRAQVESLVRQGILHHI 163
            .|  |..:||      :...|.:||
  Fly   110 VK--QGIIPR------IVNDIFNHI 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:473979 33/88 (38%)
GINS_B_Psf1 115..163 CDD:412032 8/47 (17%)
KhcNP_476590.1 KISc_KHC_KIF5 10..333 CDD:276820 44/147 (30%)
Smc <341..>807 CDD:440809
Khc_CBD_cc 856..925 CDD:467880
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.