DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32318 and Klp10A

DIOPT Version :10

Sequence 1:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_572687.1 Gene:Klp10A / 32049 FlyBaseID:FBgn0030268 Length:805 Species:Drosophila melanogaster


Alignment Length:113 Identity:27/113 - (23%)
Similarity:38/113 - (33%) Gaps:26/113 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 SVTPPVQA--------PYLLR---FVPDRVTDDSGAMISDSVQRTNNFRPQEGRWLTRTVLDHAG 490
            |..||:..        |.|:|   .|...:..|:|....||.|.||..|........||.  ...
  Fly   148 SPPPPMSEVRYGSGVNPALMRETLTVERSIRYDNGLASIDSRQWTNERRDNRAPDSYRTY--EPD 210

  Fly   491 RECFVIRIRVGKGVFKRGGEV---PSPVKSEERITEVRVGSWSYVEGS 535
            :.|        ..::::|..:   ||....:......|.|  .|||.|
  Fly   211 QPC--------HSLYQKGQSISYYPSEAAGKTTARNNRTG--YYVEDS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32318NP_995952.1 Motor_domain 17..>106 CDD:473979
GINS_B_Psf1 115..163 CDD:412032
Klp10ANP_572687.1 KISc_KIF2_like 278..608 CDD:276818
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.