DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33262 and CG14720

Sequence 1:NP_996071.2 Gene:CG33262 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_650108.2 Gene:CG14720 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster

Alignment Length:192 Identity:73/193 (38%)
Similarity:100/193 (52%) Gaps:38/193 (20%)


  Fly    10 CATLCLIFLQEVASQDVH-SRSKRFLIFPRQAPTRHQFIAGIGIPAD-LEYESLTVGYVLKAEYY 72
            |..||        |.|.| .|..|.||||..:|||.|||.|||||.: |.:||:|.||||||||:
  Fly    13 CMHLC--------SADGHLKRLSRSLIFPPTSPTRVQFIGGIGIPVENLHFESVTSGYVLKAEYF 69

  Fly    73 LPYNAT----VYRQNPLFPEYKPNTIDAQDQRK----LFMKPTDLRWQLYQFIEHMLNGYGLNGH 129
            ||.|:|    ||        .||..|..:::..    |:      ||.:|:.||.::...||.|.
  Fly    70 LPTNSTEITRVY--------LKPMAITGREKESPYGALY------RWIIYRGIEMVIENMGLPGR 120

  Fly   130 ACLLEAICEANNIKFAKDFSTAGEMLHLLLSPSST---LNSESNRALDFILAEKDGSR-RDC 187
            :|||..|||...:....:....||:::::|.|||:   |...|:|  ::..:|..|.| .||
  Fly   121 SCLLRLICEHAALPLNHESGLLGEIMNIVLRPSSSVDQLGQSSDR--EYHTSEHFGKRGGDC 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 28/83 (34%)
CG14720NP_650108.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2D2P6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.