DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33262 and CG14115

Sequence 1:NP_996071.2 Gene:CG33262 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_648629.1 Gene:CG14115 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster

Alignment Length:201 Identity:47/202 (23%)
Similarity:80/202 (40%) Gaps:36/202 (18%)


  Fly    33 FLIFPRQAPTRHQFIAGIGIPADLEYESLTVGYVLKAEYYLPYNATVYRQ--------------- 82
            ||:||||.  ....:|.:.||.:|..:::.:.:..::.|.||.|.: |.|               
  Fly    24 FLVFPRQG--SFGLLAAVAIPLELGPKNVYMAFNFESNYALPSNDS-YNQWIDRWDLDDHYLGVG 85

  Fly    83 ---NPL--------FPEYKPNTIDAQDQRKLFMKPTDLRWQLYQFIEHMLNGYGLNGHACLLEAI 136
               .|:        |.:.:.|.:   .:|.:...|...|...|:.|.:.|..||.||.||||..|
  Fly    86 GNVTPINARQDGGDFSQDEDNEV---RRRSVGSPPPFRRHDFYRSIINFLTHYGFNGSACLLRTI 147

  Fly   137 CEANNIKFAKDFSTAGEMLHLLLSPSSTLNSESNRALDFILAEKDGSRR--DCSKY--DCNTKII 197
            ||.:...........|.:..:|..|:::...:..:.:|.:....|....  .||:|  .|....:
  Fly   148 CEVSESPLDDQNGLLGSLFQILFMPTTSAAEQELQHVDELYKASDAGTHGPGCSEYVAHCGHSAL 212

  Fly   198 NWFSFV 203
            :..|.|
  Fly   213 DLISIV 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 23/86 (27%)
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 25/98 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2D2P6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.