DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ind and unpg

Sequence 1:NP_996087.2 Gene:ind FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:435 Identity:110/436 (25%)
Similarity:149/436 (34%) Gaps:165/436 (38%)


  Fly    13 DRPNLSQKKEKLGSPGGSPTAAAA-----------VAAAAMLPSIPMLPYPASYVGSYLFSLGIQ 66
            :||.|.|..| :|:. .|||...|           ...|...|:....|.|..           :
  Fly     2 ERPALLQNGE-IGTM-ESPTTRLASKPFPKPFSIESLIANQTPATATPPSPPE-----------E 53

  Fly    67 QQQQQQQQQQQHAAAAAAAAAAAAALQQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNYE----- 126
            :.|:|:.:|:|..:|.|..|::|..|.|.|        ||:|:...:.::       |:|     
  Fly    54 RDQEQEAEQEQELSARAMVASSALGLTQFP--------LYNPWLHGYFAQ-------NHERLTHL 103

  Fly   127 ---GCY-------------------PSPPLSANPN---SQQLPP--------------------- 145
               |||                   |.||....|.   .:||||                     
  Fly   104 IAGGCYLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVA 168

  Fly   146 -----------------IHNL------------------YGSPVVGGLPLPEPGSFCTSPSASSS 175
                             :|:|                  ..:|.:..|..|.|....:||:.|.|
  Fly   169 PTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGS 233

  Fly   176 AS-----LD-------------------------YTNNFDEPQGKRFKHESS--CSPNSSPLKNH 208
            .|     ||                         |....|:.:...:.:..|  ||.:......|
  Fly   234 HSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRH 298

  Fly   209 SSGGPVEITPLINDYADSSK--RIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQV 271
            ..||........|..:.:||  |.||||||.|||||||||....|||...|.:||..|:|||.||
  Fly   299 EGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQV 363

  Fly   272 KIWFQNRRVKQK--KGGSESPTFNLSTNSNGSPQASPVSPQVKVH 314
            ||||||||.|.|  |.|..|.    ....||:...:.:...:.||
  Fly   364 KIWFQNRRAKWKRVKAGLTSH----GLGRNGTTSGTKIVVPIPVH 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
indNP_996087.2 Homeobox 231..283 CDD:278475 36/52 (69%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.