DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33257 and CG34459

Sequence 1:NP_996107.1 Gene:CG33257 FlyBaseID:FBgn0053257 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001097348.1 Gene:CG34459 FlyBaseID:FBgn0085488 Length:305 Species:Drosophila melanogaster

Alignment Length:322 Identity:82/323 (25%)
Similarity:139/323 (43%) Gaps:88/323 (27%)


  Fly     6 LRFLLAQLVLVLLLSNALGRLHKRNGYHYRPQQPPPIHQGGYFEPH-----LPAVEPPEPEK--P 63
            :|.:||..::.|.|     .||...| |..||:..|.|: ...:|.     ..|::.|...:  |
  Fly     3 IRGVLAMYLMFLRL-----LLHCTTG-HTLPQRHSPQHK-RMIDPRELLNDFAAIKEPGTSEVAP 60

  Fly    64 QHSTKS--YYTTSGGSSSVSSKGSG-GYSIGSGLRS----------------------------- 96
            ::|.:|  .|...|..|     ||| |.:.|.|..:                             
  Fly    61 KNSARSIALYNAGGAMS-----GSGEGTAPGPGTDNSKSASNKQCDPQAKCNVKTIITPGDPKQK 120

  Fly    97 ---IAQGSADQAHSAVTNQHAAAKQAAYIAQNTLAQAASQAAATAQAALVGKQVVLQELEQQAAE 158
               ||..:|..|.:|...|.||.:.||...:..||:.|.|:|..|:|||:|||:::.:|||:..|
  Fly   121 SSMIAMKAAQDAKAASEAQSAAGQAAAQHIKMELAEKAFQSAKAAEAALMGKQMMVDQLEQEVQE 185

  Fly   159 AQRSLSRELEQLKAAKISARLAQQTAQAAHHHISVLTAAVNNAKSVAEQ----------AEQTST 213
            |                 :.:.::.:.:.||..:.:.|||...|...:|          |.::.|
  Fly   186 A-----------------SAVVEEESNSIHHTEANMNAAVEAVKVAVQQFETINELQKTARESLT 233

  Fly   214 EV-------NNQLASQSQMVGQSKNRLEQVEEQLHQARVDYAATKESALKAANSAAAAQVNA 268
            .:       ..::|:::|::..::||:..:::||..|..||..||::|.|||.:|..|:..|
  Fly   234 NIQTVAMGSQQEMAAKTQLLEAARNRMAMLQKQLVSAHDDYEKTKQAAYKAACAAVEAKQRA 295

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33257NP_996107.1 SNARE 195..240 CDD:304603 12/62 (19%)
DUF745 94..252 CDD:283087 47/207 (23%)
CG34459NP_001097348.1 DUF745 115..295 CDD:283087 53/197 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.