DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33257 and CG14840

DIOPT Version :9

Sequence 1:NP_996107.1 Gene:CG33257 / 2768960 FlyBaseID:FBgn0053257 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_650349.1 Gene:CG14840 / 41734 FlyBaseID:FBgn0038217 Length:300 Species:Drosophila melanogaster


Alignment Length:283 Identity:84/283 - (29%)
Similarity:135/283 - (47%) Gaps:48/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLVLLLSNALGRLHKRNGYHYRPQQPPPIHQGGYFEPHLPAVEPPEPEKPQHSTKSYYTTS--- 74
            |:|||||..|..||   ..||||                     |.|....|..:..|...|   
  Fly     7 LLLVLLLLRAFPRL---ESYHYR---------------------PAETNDKQCLSALYGDASIDG 47

  Fly    75 -GGSSSV--SSKGSG--------GYSIGSGL----------RSIAQGSADQAHSAVTNQHAAAKQ 118
             ||:..:  .|:|.|        |.|.|:|:          .:|||.:|.:|.:|..:|.|||:.
  Fly    48 TGGAGGLGGGSEGCGEPNSKKGVGCSSGTGVFGRGDPKQKASNIAQKAAQEAKAASDSQMAAAEA 112

  Fly   119 AAYIAQNTLAQAASQAAATAQAALVGKQVVLQELEQQAAEAQRSLSRELEQLKAAKISARLAQQT 183
            ||...:|.||..|:|:|..|:|||.|||.::::|:|:..||...::.....|:..:.:|..|...
  Fly   113 AASQVKNELAAKAAQSARAAEAALAGKQQIVEQLQQEMTEADAVVTEVTSSLQNTQANANAAASA 177

  Fly   184 AQAAHHHISVLTAAVNNAKSVAEQAEQTSTEVNNQLASQSQMVGQSKNRLEQVEEQLHQARVDYA 248
            |..|...::.|...|..|.|.....|..::....:||.::|::..:|:|:|.:..|:.:|:.|:.
  Fly   178 AHEAQSQLNQLKNLVIAATSNLANIENVASGAQQELAEKTQLLEAAKHRVENLTRQMTEAKTDFE 242

  Fly   249 ATKESALKAANSAAAAQVNASKA 271
            .||::|.|||.:|..|:..|.::
  Fly   243 KTKQAAYKAACAAVEAKQKAQRS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33257NP_996107.1 DUF745 94..252 CDD:283087 49/167 (29%)
SNARE 195..240 CDD:304603 10/44 (23%)
CG14840NP_650349.1 DUF745 82..262 CDD:283087 56/179 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.