DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33257 and CG14840

Sequence 1:NP_996107.1 Gene:CG33257 FlyBaseID:FBgn0053257 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_650349.1 Gene:CG14840 FlyBaseID:FBgn0038217 Length:300 Species:Drosophila melanogaster

Alignment Length:283 Identity:84/284 (30%)
Similarity:135/284 (48%) Gaps:48/284 (17%)


  Fly    13 LVLVLLLSNALGRLHKRNGYHYRPQQPPPIHQGGYFEPHLPAVEPPEPEKPQHSTKSYYTTS--- 74
            |:|||||..|..||   ..||||                     |.|....|..:..|...|   
  Fly     7 LLLVLLLLRAFPRL---ESYHYR---------------------PAETNDKQCLSALYGDASIDG 47

  Fly    75 -GGSSSV--SSKGSG--------GYSIGSGL----------RSIAQGSADQAHSAVTNQHAAAKQ 118
             ||:..:  .|:|.|        |.|.|:|:          .:|||.:|.:|.:|..:|.|||:.
  Fly    48 TGGAGGLGGGSEGCGEPNSKKGVGCSSGTGVFGRGDPKQKASNIAQKAAQEAKAASDSQMAAAEA 112

  Fly   119 AAYIAQNTLAQAASQAAATAQAALVGKQVVLQELEQQAAEAQRSLSRELEQLKAAKISARLAQQT 183
            ||...:|.||..|:|:|..|:|||.|||.::::|:|:..||...::.....|:..:.:|..|...
  Fly   113 AASQVKNELAAKAAQSARAAEAALAGKQQIVEQLQQEMTEADAVVTEVTSSLQNTQANANAAASA 177

  Fly   184 AQAAHHHISVLTAAVNNAKSVAEQAEQTSTEVNNQLASQSQMVGQSKNRLEQVEEQLHQARVDYA 248
            |..|...::.|...|..|.|.....|..::....:||.::|::..:|:|:|.:..|:.:|:.|:.
  Fly   178 AHEAQSQLNQLKNLVIAATSNLANIENVASGAQQELAEKTQLLEAAKHRVENLTRQMTEAKTDFE 242

  Fly   249 ATKESALKAANSAAAAQVNASKA 271
            .||::|.|||.:|..|:..|.::
  Fly   243 KTKQAAYKAACAAVEAKQKAQRS 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33257NP_996107.1 SNARE 195..240 CDD:304603 11/45 (24%)
DUF745 94..252 CDD:283087 50/168 (30%)
CG14840NP_650349.1 DUF745 82..262 CDD:283087 56/180 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.