DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33257 and CG11694

DIOPT Version :9

Sequence 1:NP_996107.1 Gene:CG33257 / 2768960 FlyBaseID:FBgn0053257 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_649786.1 Gene:CG11694 / 40985 FlyBaseID:FBgn0037571 Length:261 Species:Drosophila melanogaster


Alignment Length:209 Identity:66/209 - (31%)
Similarity:106/209 - (50%) Gaps:7/209 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GSSSVSSKGSGG---YSIGSGLR----SIAQGSADQAHSAVTNQHAAAKQAAYIAQNTLAQAASQ 133
            |.:||||...|.   :.:....|    .|||.:|.:|..|...|..|.:.||...:..||..|..
  Fly    41 GDNSVSSSSGGAPCDFKMNGKTRVKASCIAQKAAKEAMEASDAQIEAGEAAARQVKQQLADKALA 105

  Fly   134 AAATAQAALVGKQVVLQELEQQAAEAQRSLSRELEQLKAAKISARLAQQTAQAAHHHISVLTAAV 198
            ||..|:|||.|||.::::||.:..|.:..:..|...|:..:.:...|.|.|:.|...::.:|.||
  Fly   106 AAKAAEAALAGKQQIVEQLESEVREGELVVQEESTLLQTTQTTYAAAGQAAKQAADQLNTITLAV 170

  Fly   199 NNAKSVAEQAEQTSTEVNNQLASQSQMVGQSKNRLEQVEEQLHQARVDYAATKESALKAANSAAA 263
            .||:.....:|..::....:|..:.|:|..:|.|:|.:..||..||||:..||.:|.|||.:|..
  Fly   171 KNAQDNVVNSEHVASGAQQELGEKQQLVEAAKKRVELLLRQLEVARVDFKNTKNAAEKAACAAQE 235

  Fly   264 AQVNASKAAQHATI 277
            |:..|::..:.|.:
  Fly   236 ARHRATRERRRAEL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33257NP_996107.1 DUF745 94..252 CDD:283087 51/161 (32%)
SNARE 195..240 CDD:304603 12/44 (27%)
CG11694NP_649786.1 Ribosomal_S11 34..>95 CDD:294237 17/53 (32%)
DUF745 60..223 CDD:283087 50/162 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.