DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33257 and CG11694

Sequence 1:NP_996107.1 Gene:CG33257 FlyBaseID:FBgn0053257 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_649786.1 Gene:CG11694 FlyBaseID:FBgn0037571 Length:261 Species:Drosophila melanogaster

Alignment Length:209 Identity:66/210 (31%)
Similarity:106/210 (50%) Gaps:7/210 (3%)


  Fly    76 GSSSVSSKGSGG---YSIGSGLR----SIAQGSADQAHSAVTNQHAAAKQAAYIAQNTLAQAASQ 133
            |.:||||...|.   :.:....|    .|||.:|.:|..|...|..|.:.||...:..||..|..
  Fly    41 GDNSVSSSSGGAPCDFKMNGKTRVKASCIAQKAAKEAMEASDAQIEAGEAAARQVKQQLADKALA 105

  Fly   134 AAATAQAALVGKQVVLQELEQQAAEAQRSLSRELEQLKAAKISARLAQQTAQAAHHHISVLTAAV 198
            ||..|:|||.|||.::::||.:..|.:..:..|...|:..:.:...|.|.|:.|...::.:|.||
  Fly   106 AAKAAEAALAGKQQIVEQLESEVREGELVVQEESTLLQTTQTTYAAAGQAAKQAADQLNTITLAV 170

  Fly   199 NNAKSVAEQAEQTSTEVNNQLASQSQMVGQSKNRLEQVEEQLHQARVDYAATKESALKAANSAAA 263
            .||:.....:|..::....:|..:.|:|..:|.|:|.:..||..||||:..||.:|.|||.:|..
  Fly   171 KNAQDNVVNSEHVASGAQQELGEKQQLVEAAKKRVELLLRQLEVARVDFKNTKNAAEKAACAAQE 235

  Fly   264 AQVNASKAAQHATI 277
            |:..|::..:.|.:
  Fly   236 ARHRATRERRRAEL 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33257NP_996107.1 SNARE 195..240 CDD:304603 13/45 (29%)
DUF745 94..252 CDD:283087 52/162 (32%)
CG11694NP_649786.1 Ribosomal_S11 34..>95 CDD:294237 17/54 (31%)
DUF745 60..223 CDD:283087 51/163 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.