DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33257 and CG11693

Sequence 1:NP_996107.1 Gene:CG33257 FlyBaseID:FBgn0053257 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001246985.1 Gene:CG11693 FlyBaseID:FBgn0037570 Length:323 Species:Drosophila melanogaster

Alignment Length:335 Identity:137/336 (41%)
Similarity:183/336 (54%) Gaps:51/336 (15%)


  Fly     6 LRFLLAQLVLVLLLSNALGRLHKRNGYHYR------PQQPPPIHQGGYFEPHLPAVEPPEPEKPQ 64
            |..||..|.||.:.:.  ||..||...||.      |..|||       .||.|...|.:....:
  Fly     5 LHLLLLALFLVAMPTQ--GRKIKRKEPHYHHHVNVPPPPPPP-------SPHGPGPVPQQTAVIE 60

  Fly    65 HSTKSY----------------------------YTTSGGSSSVSSKGSGGYSIGSGLRSIAQGS 101
            |....|                            ::..||...    |||||...:||||||:||
  Fly    61 HEVPPYTYEAINHDEFEPAKVKLSHFEGSSDYIVHSHRGGGGG----GSGGYLADNGLRSIAKGS 121

  Fly   102 ADQAHSAVTNQHAAAKQAAYIAQNTLAQAASQAAATAQAALVGKQVVLQELEQQAAEAQRSLSRE 166
            ||||.|||.:|:||.|||:|:|::||||||:|||.||.|.|.||:|:|..||.|:.||.:::..|
  Fly   122 ADQALSAVASQNAAGKQASYVAKSTLAQAAAQAAGTAVAVLKGKEVLLHRLEDQSVEAHKAMENE 186

  Fly   167 LEQLKAAKISARLAQQTAQAAHHHISVLTAAVNNAKSVAEQAEQTSTEVNNQLASQSQMVGQSKN 231
            |.||:.||.||:.||..||.|.:|:||||||:|||:|.:|.|::.::|...:||||..||.|:|.
  Fly   187 LTQLQQAKRSAKAAQYAAQQAINHVSVLTAALNNAQSASELAQKAASEAAAELASQIDMVAQAKT 251

  Fly   232 RLEQVEEQLHQARVDYAATKESALKAANSAAAAQVNASKAAQHATIGLHESTNPSAHGHDGQELG 296
            :||..|.|.:.||:||..|:::|.||..||..|.:||:.||.||.:.|.|    :.|.||..:..
  Fly   252 KLEHAESQAYAARLDYEETRDAAEKATLSAQEAHLNANDAALHANVELAE----NVHIHDKSDRN 312

  Fly   297 GEEESYDEHL 306
            ..|...:..|
  Fly   313 VREPPRNHRL 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33257NP_996107.1 SNARE 195..240 CDD:304603 22/45 (49%)
DUF745 94..252 CDD:283087 88/158 (56%)
CG11693NP_001246985.1 DUF745 108..288 CDD:283087 97/180 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139737687
eggNOG 1 0.900 E1_2C6CE
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.