DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and si:dkeyp-72e1.7

DIOPT Version :8

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_691639.1 Gene:si:dkeyp-72e1.7 / 563178 ZFINID:ZDB-GENE-120215-229 Length:199 Species:Danio rerio

Alignment Length:165 Identity:53/166 (32%)
Similarity:88/166 (53%) Gaps:9/166 (5%)


  Fly    16 PFVTNSAIYGSLYVGAEYSQQFASKRWLATASKPEDIDYATIGRYAVMGTAVYAPTLYLWYKWLD 80
            |:::|..:||.|:.|.::..|..::|        :::|:......|::..:......|.|.:.|:
Zfish    16 PWISNVTLYGCLFAGGDFVHQCIAQR--------DEMDWRHTRNVAIVALSFQGNFNYFWLRALE 72

  Fly    81 RAFPGTTKVIIVKKLVLDQFVLTPYLLTVFYAGMSIMEGSADIFLELREKFVPTFMRSCIFWLPA 145
            ..|||.:..::.:||||||...:|...:|||.|:|.:||..|||.:.||||..|:....::|...
Zfish    73 SRFPGRSAGMVFRKLVLDQSFASPLATSVFYTGVSFLEGKEDIFEDWREKFFNTYKTGLMYWPFM 137

  Fly   146 QALNFSLVAPRFRVIYMGICGLIWVNILCWTKRQS 180
            |.|||.|:....|..:||....:|...||:: |||
Zfish   138 QFLNFVLMPLYLRTAFMGCSAFVWATFLCFS-RQS 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 22/62 (35%)
si:dkeyp-72e1.7XP_691639.1 Mpv17_PMP22 108..167 CDD:282035 22/59 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H13547
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005779
OrthoInspector 1 1.000 T596022
orthoMCL 1 0.900 OOG5_135538
Panther 1 1.100 O PTHR11266
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.