DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33259 and B0238.12

DIOPT Version :9

Sequence 1:NP_996090.1 Gene:CG33259 / 2768950 FlyBaseID:FBgn0036495 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001379552.1 Gene:B0238.12 / 178914 WormBaseID:WBGene00015076 Length:166 Species:Caenorhabditis elegans


Alignment Length:49 Identity:19/49 - (38%)
Similarity:25/49 - (51%) Gaps:2/49 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 CPTACPETCDTKGKPNCTLIC-GGPCVCKPGYVVNRMIPACVLRSDCPK 83
            |.|||..:| |...|.||..| ...|.|:.|||.|.:...||.::.|.:
 Worm    47 CGTACEPSC-TNPNPMCTKQCINNVCQCRSGYVRNEITRQCVRQAQCSR 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33259NP_996090.1 TIL 27..81 CDD:280072 18/45 (40%)
B0238.12NP_001379552.1 TIL 39..92 CDD:410995 18/45 (40%)
TIL 113..166 CDD:410995
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.