DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33259 and spi-2

DIOPT Version :10

Sequence 1:NP_996090.1 Gene:CG33259 / 2768950 FlyBaseID:FBgn0036495 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001379552.1 Gene:spi-2 / 178914 WormBaseID:WBGene00015076 Length:166 Species:Caenorhabditis elegans


Alignment Length:49 Identity:19/49 - (38%)
Similarity:25/49 - (51%) Gaps:2/49 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 CPTACPETCDTKGKPNCTLIC-GGPCVCKPGYVVNRMIPACVLRSDCPK 83
            |.|||..:| |...|.||..| ...|.|:.|||.|.:...||.::.|.:
 Worm    47 CGTACEPSC-TNPNPMCTKQCINNVCQCRSGYVRNEITRQCVRQAQCSR 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33259NP_996090.1 TIL 27..81 CDD:460351 18/45 (40%)
spi-2NP_001379552.1 TIL 39..92 CDD:410995 18/45 (40%)
TIL 113..166 CDD:410995
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.