powered by:
Protein Alignment CG33259 and B0238.12
DIOPT Version :9
Sequence 1: | NP_996090.1 |
Gene: | CG33259 / 2768950 |
FlyBaseID: | FBgn0036495 |
Length: | 119 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379552.1 |
Gene: | B0238.12 / 178914 |
WormBaseID: | WBGene00015076 |
Length: | 166 |
Species: | Caenorhabditis elegans |
Alignment Length: | 49 |
Identity: | 19/49 - (38%) |
Similarity: | 25/49 - (51%) |
Gaps: | 2/49 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 CPTACPETCDTKGKPNCTLIC-GGPCVCKPGYVVNRMIPACVLRSDCPK 83
|.|||..:| |...|.||..| ...|.|:.|||.|.:...||.::.|.:
Worm 47 CGTACEPSC-TNPNPMCTKQCINNVCQCRSGYVRNEITRQCVRQAQCSR 94
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33259 | NP_996090.1 |
TIL |
27..81 |
CDD:280072 |
18/45 (40%) |
B0238.12 | NP_001379552.1 |
TIL |
39..92 |
CDD:410995 |
18/45 (40%) |
TIL |
113..166 |
CDD:410995 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.