DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Urm1 and URM1

Sequence 1:NP_996018.2 Gene:Urm1 FlyBaseID:FBgn0053276 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_012258.3 Gene:URM1 SGDID:S000001270 Length:99 Species:Saccharomyces cerevisiae

Alignment Length:98 Identity:36/99 (36%)
Similarity:62/99 (63%) Gaps:2/99 (2%)


  Fly     6 LKIILEFSAGAELLFGNIKRRELNLDGKQKWTIANLLKWMHANILTERPE--LFLQGDTVRPGIL 68
            :.:.:||..|.:.:||..:..::.:|.:...|:.:|:..:.:.::....:  :|::.|::||||:
Yeast     2 VNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGII 66

  Fly    69 VLINDTDWELLGELDYELQPNDNVLFISTLHGG 101
            .|||||||||.||.||.|:..|.:.|.||||||
Yeast    67 TLINDTDWELEGEKDYILEDGDIISFTSTLHGG 99

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Urm1NP_996018.2 Urm1 7..101 CDD:286251 35/96 (36%)
URM1NP_012258.3 Urm1 3..99 CDD:312605 35/96 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C162092635
eggNOG 1 0.900 E1_COG5131
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1610
Isobase 1 0.950 0 Normalized mean entropy S1009
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003881
OrthoInspector 1 1.000 T1135941
orthoMCL 1 0.900 OOG5_128383
Panther 1 1.100 LDO PTHR14986
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1611
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.