DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Urm1 and URM1

DIOPT Version :9

Sequence 1:NP_996018.2 Gene:Urm1 / 2768949 FlyBaseID:FBgn0053276 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_012258.3 Gene:URM1 / 854809 SGDID:S000001270 Length:99 Species:Saccharomyces cerevisiae


Alignment Length:98 Identity:36/98 - (36%)
Similarity:62/98 - (63%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LKIILEFSAGAELLFGNIKRRELNLDGKQKWTIANLLKWMHANILTERPE--LFLQGDTVRPGIL 68
            :.:.:||..|.:.:||..:..::.:|.:...|:.:|:..:.:.::....:  :|::.|::||||:
Yeast     2 VNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGII 66

  Fly    69 VLINDTDWELLGELDYELQPNDNVLFISTLHGG 101
            .|||||||||.||.||.|:..|.:.|.||||||
Yeast    67 TLINDTDWELEGEKDYILEDGDIISFTSTLHGG 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Urm1NP_996018.2 Urm1 7..101 CDD:286251 34/95 (36%)
URM1NP_012258.3 Urm1 3..99 CDD:370315 34/95 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345597
Domainoid 1 1.000 78 1.000 Domainoid score I2065
eggNOG 1 0.900 - - E1_COG5131
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1635
Isobase 1 0.950 - 0 Normalized mean entropy S1009
OMA 1 1.010 - - QHG53739
OrthoFinder 1 1.000 - - FOG0004387
OrthoInspector 1 1.000 - - oto100032
orthoMCL 1 0.900 - - OOG6_102802
Panther 1 1.100 - - LDO PTHR14986
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1611
SonicParanoid 1 1.000 - - X3670
TreeFam 1 0.960 - -
1514.740

Return to query results.
Submit another query.