DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Urm1 and URM1

DIOPT Version :8

Sequence 1:NP_996018.2 Gene:Urm1 / 2768949 FlyBaseID:FBgn0053276 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001129419.1 Gene:URM1 / 81605 HGNCID:28378 Length:146 Species:Homo sapiens

Alignment Length:80 Identity:48/80 - (60%)
Similarity:59/80 - (73%) Gaps:2/80 - (2%)


  Fly     1 MGTPELKIILEFSAGAELLFGNIKRRELNLDGKQK-WTIANLLKWMHANILTERPELFLQGDTVR 64
            |..| |.:.:||..||||||..||:..:.|.|::: |.|.|||.|:..|:|.||||||:|||:||
Human     1 MAAP-LSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVR 64

  Fly    65 PGILVLINDTDWELL 79
            |||||||||.|||||
Human    65 PGILVLINDADWELL 79

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Urm1NP_996018.2 Urm1 7..101 CDD:286251 45/74 (61%)
URM1NP_001129419.1 Urm1 6..>79 CDD:286251 43/72 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C162083499
eggNOG 1 0.900 E1_COG5131
Hieranoid 1 1.000
Homologene 1 1.000 H41688
Inparanoid 1 1.050 133 1.000 Inparanoid score I4533
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003881
OrthoInspector 1 1.000 T1073143
orthoMCL 1 0.900 OOG5_128383
Panther 1 1.100 LDO PTHR14986
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1611
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.