DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Urm1 and Urm1

DIOPT Version :9

Sequence 1:NP_996018.2 Gene:Urm1 / 2768949 FlyBaseID:FBgn0053276 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_080891.1 Gene:Urm1 / 68205 MGIID:1915455 Length:101 Species:Mus musculus


Alignment Length:102 Identity:64/102 - (62%)
Similarity:80/102 - (78%) Gaps:2/102 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGTPELKIILEFSAGAELLFGNIKRRELNLDGKQK-WTIANLLKWMHANILTERPELFLQGDTVR 64
            |..| |.:.:||..||||||..:|:.::.|.|::: |.|.|||.|:..|:|.||||||:|||:||
Mouse     1 MAAP-LCVKVEFGGGAELLFDGVKKHQVALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVR 64

  Fly    65 PGILVLINDTDWELLGELDYELQPNDNVLFISTLHGG 101
            |||||||||.||||||||||:||..|::|||||||||
Mouse    65 PGILVLINDADWELLGELDYQLQDQDSILFISTLHGG 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Urm1NP_996018.2 Urm1 7..101 CDD:286251 59/94 (63%)
Urm1NP_080891.1 Urm1 6..101 CDD:286251 60/95 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847364
Domainoid 1 1.000 131 1.000 Domainoid score I5141
eggNOG 1 0.900 - - E1_COG5131
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41688
Inparanoid 1 1.050 132 1.000 Inparanoid score I4597
Isobase 1 0.950 - 0 Normalized mean entropy S1009
OMA 1 1.010 - - QHG53739
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004387
OrthoInspector 1 1.000 - - oto94525
orthoMCL 1 0.900 - - OOG6_102802
Panther 1 1.100 - - LDO PTHR14986
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1611
SonicParanoid 1 1.000 - - X3670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.