DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Urm1 and Urm1

Sequence 1:NP_996018.2 Gene:Urm1 FlyBaseID:FBgn0053276 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_080891.1 Gene:Urm1 MGIID:1915455 Length:101 Species:Mus musculus

Alignment Length:102 Identity:64/103 (62%)
Similarity:80/103 (78%) Gaps:2/103 (2%)


  Fly     1 MGTPELKIILEFSAGAELLFGNIKRRELNLDGKQK-WTIANLLKWMHANILTERPELFLQGDTVR 64
            |..| |.:.:||..||||||..:|:.::.|.|::: |.|.|||.|:..|:|.||||||:|||:||
Mouse     1 MAAP-LCVKVEFGGGAELLFDGVKKHQVALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVR 64

  Fly    65 PGILVLINDTDWELLGELDYELQPNDNVLFISTLHGG 101
            |||||||||.||||||||||:||..|::|||||||||
Mouse    65 PGILVLINDADWELLGELDYQLQDQDSILFISTLHGG 101

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Urm1NP_996018.2 Urm1 7..101 CDD:286251 60/95 (63%)
Urm1NP_080891.1 Urm1 6..101 CDD:286251 61/96 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C162083644
eggNOG 1 0.900 E1_COG5131
Hieranoid 1 1.000
Homologene 1 1.000 H41688
Inparanoid 1 1.050 132 1.000 Inparanoid score I4570
Isobase 1 0.950 0 Normalized mean entropy S1009
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003881
OrthoInspector 1 1.000 T1083212
orthoMCL 1 0.900 OOG5_128383
Panther 1 1.100 LDO PTHR14986
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1611
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.