DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Urm1 and AT3G61113

Sequence 1:NP_996018.2 Gene:Urm1 FlyBaseID:FBgn0053276 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001118872.1 Gene:AT3G61113 AraportID:AT3G61113 Length:99 Species:Arabidopsis thaliana

Alignment Length:99 Identity:49/100 (49%)
Similarity:70/100 (70%) Gaps:3/100 (3%)


  Fly     6 LKIILEFSAGAELLFGNIKRRELN---LDGKQKWTIANLLKWMHANILTERPELFLQGDTVRPGI 67
            ::..|||..|.|||..::|..::|   |:.....|:.:||.|:..|::.||||:|::|||||||:
plant     1 MQFTLEFGGGLELLCDSVKIHKVNINLLNDSDILTMKDLLSWVRTNLIKERPEMFMKGDTVRPGV 65

  Fly    68 LVLINDTDWELLGELDYELQPNDNVLFISTLHGG 101
            |||:||.||||.|:||..|:..|.::||||||||
plant    66 LVLVNDCDWELSGQLDTTLEDKDVIVFISTLHGG 99

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Urm1NP_996018.2 Urm1 7..101 CDD:286251 48/97 (49%)
AT3G61113NP_001118872.1 Urm1 4..99 CDD:286251 48/95 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H41688
Inparanoid 1 1.050 105 1.000 Inparanoid score I2064
OMA 1 1.010
OrthoDB 1 1.010 D1541629at2759
OrthoInspector 1 1.000 T125021
orthoMCL 1 0.900 OOG5_128383
Panther 1 1.100 O PTHR14986
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.